BLASTX nr result
ID: Rehmannia30_contig00026733
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00026733 (447 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN17463.1| hypothetical protein CDL12_09864 [Handroanthus im... 64 5e-09 ref|XP_011094271.1| UPF0496 protein At3g19330 [Sesamum indicum] ... 64 5e-09 ref|XP_012828684.1| PREDICTED: UPF0496 protein At3g19330-like [E... 59 2e-07 gb|KZV43157.1| hypothetical protein F511_40541 [Dorcoceras hygro... 57 2e-06 gb|PIN14182.1| hypothetical protein CDL12_13188 [Handroanthus im... 56 2e-06 >gb|PIN17463.1| hypothetical protein CDL12_09864 [Handroanthus impetiginosus] Length = 371 Score = 63.9 bits (154), Expect = 5e-09 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -2 Query: 113 TNNYLSSPTSQGYSGENTPASSVQLSPTINLTREYTL 3 T+N +SSP SQGYS +NTP SSVQLSPT+NLTREYTL Sbjct: 13 TSNNISSPASQGYSADNTPTSSVQLSPTVNLTREYTL 49 >ref|XP_011094271.1| UPF0496 protein At3g19330 [Sesamum indicum] ref|XP_011094275.1| UPF0496 protein At3g19330 [Sesamum indicum] ref|XP_011094276.1| UPF0496 protein At3g19330 [Sesamum indicum] ref|XP_020553231.1| UPF0496 protein At3g19330 [Sesamum indicum] ref|XP_020553233.1| UPF0496 protein At3g19330 [Sesamum indicum] ref|XP_020553234.1| UPF0496 protein At3g19330 [Sesamum indicum] Length = 381 Score = 63.9 bits (154), Expect = 5e-09 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -2 Query: 113 TNNYLSSPTSQGYSGENTPASSVQLSPTINLTREYTL 3 TNNYLSSP SQGYS + TP SSVQLSPT+NL+REYTL Sbjct: 22 TNNYLSSPASQGYSEDITPPSSVQLSPTVNLSREYTL 58 >ref|XP_012828684.1| PREDICTED: UPF0496 protein At3g19330-like [Erythranthe guttata] Length = 328 Score = 59.3 bits (142), Expect = 2e-07 Identities = 28/38 (73%), Positives = 34/38 (89%), Gaps = 2/38 (5%) Frame = -2 Query: 110 NNYLS--SPTSQGYSGENTPASSVQLSPTINLTREYTL 3 NN++S SPTSQGYS +NTP SSVQLSPT+NL+RE+TL Sbjct: 12 NNHISISSPTSQGYSADNTPTSSVQLSPTVNLSREFTL 49 >gb|KZV43157.1| hypothetical protein F511_40541 [Dorcoceras hygrometricum] Length = 381 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -2 Query: 110 NNYLSSPTSQGYSGENTPASSVQLSPTINLTREYTL 3 NN++SSP SQGYS +NTP SSVQLS T+NL+ EY+L Sbjct: 20 NNHISSPVSQGYSADNTPTSSVQLSSTVNLSGEYSL 55 >gb|PIN14182.1| hypothetical protein CDL12_13188 [Handroanthus impetiginosus] gb|PIN16119.1| hypothetical protein CDL12_11228 [Handroanthus impetiginosus] Length = 392 Score = 56.2 bits (134), Expect = 2e-06 Identities = 26/36 (72%), Positives = 28/36 (77%) Frame = -2 Query: 113 TNNYLSSPTSQGYSGENTPASSVQLSPTINLTREYT 6 TN Y SSP SQG+S ENTP SS Q SPTINLT E+T Sbjct: 30 TNTYFSSPASQGHSVENTPRSSAQFSPTINLTEEFT 65