BLASTX nr result
ID: Rehmannia30_contig00026609
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00026609 (459 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN07822.1| Serine/threonine protein kinase [Handroanthus imp... 94 2e-19 ref|XP_017191382.1| PREDICTED: probable serine/threonine-protein... 92 1e-18 ref|XP_009374365.1| PREDICTED: probable serine/threonine-protein... 92 1e-18 ref|XP_009374364.1| PREDICTED: probable serine/threonine-protein... 92 1e-18 gb|PON66168.1| Serine/threonine protein kinase [Trema orientalis] 92 1e-18 gb|PON37669.1| Serine/threonine protein kinase [Parasponia ander... 92 1e-18 ref|XP_020550387.1| probable serine/threonine-protein kinase WNK... 91 3e-18 ref|XP_020550386.1| probable serine/threonine-protein kinase WNK... 91 3e-18 ref|XP_011080727.1| probable serine/threonine-protein kinase WNK... 91 3e-18 gb|OMP02317.1| hypothetical protein COLO4_11198 [Corchorus olito... 90 5e-18 gb|OMO82963.1| hypothetical protein CCACVL1_11631 [Corchorus cap... 90 5e-18 gb|ONH99673.1| hypothetical protein PRUPE_6G042600 [Prunus persica] 90 5e-18 gb|ONH99674.1| hypothetical protein PRUPE_6G042600 [Prunus persica] 90 6e-18 ref|XP_016650948.1| PREDICTED: probable serine/threonine-protein... 90 6e-18 ref|XP_021810591.1| probable serine/threonine-protein kinase WNK... 90 6e-18 ref|XP_007207424.2| probable serine/threonine-protein kinase WNK... 90 6e-18 ref|XP_008242759.1| PREDICTED: probable serine/threonine-protein... 90 6e-18 gb|EYU36911.1| hypothetical protein MIMGU_mgv1a003239mg [Erythra... 90 6e-18 ref|XP_004294736.1| PREDICTED: probable serine/threonine-protein... 90 6e-18 ref|XP_012838103.1| PREDICTED: probable serine/threonine-protein... 90 6e-18 >gb|PIN07822.1| Serine/threonine protein kinase [Handroanthus impetiginosus] gb|PIN11482.1| Serine/threonine protein kinase [Handroanthus impetiginosus] Length = 609 Score = 94.0 bits (232), Expect = 2e-19 Identities = 45/48 (93%), Positives = 46/48 (95%) Frame = +2 Query: 2 LQRLYSEVHLLSTLDHDSIIRFYTSWIDVENRKLNFITEMFTSGTLRE 145 LQRLYSEVHLLSTL+HDSIIRFYTSWIDVENR NFITEMFTSGTLRE Sbjct: 69 LQRLYSEVHLLSTLNHDSIIRFYTSWIDVENRTFNFITEMFTSGTLRE 116 >ref|XP_017191382.1| PREDICTED: probable serine/threonine-protein kinase WNK5 [Malus domestica] Length = 453 Score = 91.7 bits (226), Expect = 1e-18 Identities = 43/48 (89%), Positives = 46/48 (95%) Frame = +2 Query: 2 LQRLYSEVHLLSTLDHDSIIRFYTSWIDVENRKLNFITEMFTSGTLRE 145 LQRLYSEVHLLSTL+HDSIIRFYTSWID+E+R NFITEMFTSGTLRE Sbjct: 62 LQRLYSEVHLLSTLNHDSIIRFYTSWIDIEHRTFNFITEMFTSGTLRE 109 >ref|XP_009374365.1| PREDICTED: probable serine/threonine-protein kinase WNK4 isoform X2 [Pyrus x bretschneideri] Length = 586 Score = 91.7 bits (226), Expect = 1e-18 Identities = 43/48 (89%), Positives = 46/48 (95%) Frame = +2 Query: 2 LQRLYSEVHLLSTLDHDSIIRFYTSWIDVENRKLNFITEMFTSGTLRE 145 LQRLYSEVHLLSTL+HDSIIRFYTSWID+E+R NFITEMFTSGTLRE Sbjct: 62 LQRLYSEVHLLSTLNHDSIIRFYTSWIDIEHRTFNFITEMFTSGTLRE 109 >ref|XP_009374364.1| PREDICTED: probable serine/threonine-protein kinase WNK4 isoform X1 [Pyrus x bretschneideri] Length = 588 Score = 91.7 bits (226), Expect = 1e-18 Identities = 43/48 (89%), Positives = 46/48 (95%) Frame = +2 Query: 2 LQRLYSEVHLLSTLDHDSIIRFYTSWIDVENRKLNFITEMFTSGTLRE 145 LQRLYSEVHLLSTL+HDSIIRFYTSWID+E+R NFITEMFTSGTLRE Sbjct: 62 LQRLYSEVHLLSTLNHDSIIRFYTSWIDIEHRTFNFITEMFTSGTLRE 109 >gb|PON66168.1| Serine/threonine protein kinase [Trema orientalis] Length = 629 Score = 91.7 bits (226), Expect = 1e-18 Identities = 44/48 (91%), Positives = 45/48 (93%) Frame = +2 Query: 2 LQRLYSEVHLLSTLDHDSIIRFYTSWIDVENRKLNFITEMFTSGTLRE 145 LQRLYSEVHLLSTL+HDSIIRFYTSWIDVE R NFITEMFTSGTLRE Sbjct: 75 LQRLYSEVHLLSTLNHDSIIRFYTSWIDVEQRTFNFITEMFTSGTLRE 122 >gb|PON37669.1| Serine/threonine protein kinase [Parasponia andersonii] Length = 629 Score = 91.7 bits (226), Expect = 1e-18 Identities = 44/48 (91%), Positives = 45/48 (93%) Frame = +2 Query: 2 LQRLYSEVHLLSTLDHDSIIRFYTSWIDVENRKLNFITEMFTSGTLRE 145 LQRLYSEVHLLSTL+HDSIIRFYTSWIDVE R NFITEMFTSGTLRE Sbjct: 75 LQRLYSEVHLLSTLNHDSIIRFYTSWIDVEQRTFNFITEMFTSGTLRE 122 >ref|XP_020550387.1| probable serine/threonine-protein kinase WNK4 isoform X3 [Sesamum indicum] Length = 588 Score = 90.5 bits (223), Expect = 3e-18 Identities = 43/48 (89%), Positives = 46/48 (95%) Frame = +2 Query: 2 LQRLYSEVHLLSTLDHDSIIRFYTSWIDVENRKLNFITEMFTSGTLRE 145 LQRLYSEVHLLSTL+H+SIIRFYTSWIDVENR NFITEMF+SGTLRE Sbjct: 33 LQRLYSEVHLLSTLNHNSIIRFYTSWIDVENRTFNFITEMFSSGTLRE 80 >ref|XP_020550386.1| probable serine/threonine-protein kinase WNK4 isoform X2 [Sesamum indicum] Length = 602 Score = 90.5 bits (223), Expect = 3e-18 Identities = 43/48 (89%), Positives = 46/48 (95%) Frame = +2 Query: 2 LQRLYSEVHLLSTLDHDSIIRFYTSWIDVENRKLNFITEMFTSGTLRE 145 LQRLYSEVHLLSTL+H+SIIRFYTSWIDVENR NFITEMF+SGTLRE Sbjct: 73 LQRLYSEVHLLSTLNHNSIIRFYTSWIDVENRTFNFITEMFSSGTLRE 120 >ref|XP_011080727.1| probable serine/threonine-protein kinase WNK4 isoform X1 [Sesamum indicum] ref|XP_020550385.1| probable serine/threonine-protein kinase WNK4 isoform X1 [Sesamum indicum] Length = 628 Score = 90.5 bits (223), Expect = 3e-18 Identities = 43/48 (89%), Positives = 46/48 (95%) Frame = +2 Query: 2 LQRLYSEVHLLSTLDHDSIIRFYTSWIDVENRKLNFITEMFTSGTLRE 145 LQRLYSEVHLLSTL+H+SIIRFYTSWIDVENR NFITEMF+SGTLRE Sbjct: 73 LQRLYSEVHLLSTLNHNSIIRFYTSWIDVENRTFNFITEMFSSGTLRE 120 >gb|OMP02317.1| hypothetical protein COLO4_11198 [Corchorus olitorius] Length = 607 Score = 90.1 bits (222), Expect = 5e-18 Identities = 42/48 (87%), Positives = 46/48 (95%) Frame = +2 Query: 2 LQRLYSEVHLLSTLDHDSIIRFYTSWIDVENRKLNFITEMFTSGTLRE 145 LQRLYSEVHLLSTL+HDSII+FYTSWIDVEN+ NFITEMFTSG+LRE Sbjct: 68 LQRLYSEVHLLSTLNHDSIIKFYTSWIDVENKTFNFITEMFTSGSLRE 115 >gb|OMO82963.1| hypothetical protein CCACVL1_11631 [Corchorus capsularis] Length = 607 Score = 90.1 bits (222), Expect = 5e-18 Identities = 42/48 (87%), Positives = 46/48 (95%) Frame = +2 Query: 2 LQRLYSEVHLLSTLDHDSIIRFYTSWIDVENRKLNFITEMFTSGTLRE 145 LQRLYSEVHLLSTL+HDSII+FYTSWIDVEN+ NFITEMFTSG+LRE Sbjct: 68 LQRLYSEVHLLSTLNHDSIIKFYTSWIDVENKTFNFITEMFTSGSLRE 115 >gb|ONH99673.1| hypothetical protein PRUPE_6G042600 [Prunus persica] Length = 468 Score = 89.7 bits (221), Expect = 5e-18 Identities = 42/48 (87%), Positives = 46/48 (95%) Frame = +2 Query: 2 LQRLYSEVHLLSTLDHDSIIRFYTSWIDVENRKLNFITEMFTSGTLRE 145 LQRLYSEVHLLSTL+HDSIIRFYTSWIDV+++ NFITEMFTSGTLRE Sbjct: 62 LQRLYSEVHLLSTLNHDSIIRFYTSWIDVDHKTFNFITEMFTSGTLRE 109 >gb|ONH99674.1| hypothetical protein PRUPE_6G042600 [Prunus persica] Length = 557 Score = 89.7 bits (221), Expect = 6e-18 Identities = 42/48 (87%), Positives = 46/48 (95%) Frame = +2 Query: 2 LQRLYSEVHLLSTLDHDSIIRFYTSWIDVENRKLNFITEMFTSGTLRE 145 LQRLYSEVHLLSTL+HDSIIRFYTSWIDV+++ NFITEMFTSGTLRE Sbjct: 33 LQRLYSEVHLLSTLNHDSIIRFYTSWIDVDHKTFNFITEMFTSGTLRE 80 >ref|XP_016650948.1| PREDICTED: probable serine/threonine-protein kinase WNK4 isoform X2 [Prunus mume] Length = 557 Score = 89.7 bits (221), Expect = 6e-18 Identities = 42/48 (87%), Positives = 46/48 (95%) Frame = +2 Query: 2 LQRLYSEVHLLSTLDHDSIIRFYTSWIDVENRKLNFITEMFTSGTLRE 145 LQRLYSEVHLLSTL+HDSIIRFYTSWIDV+++ NFITEMFTSGTLRE Sbjct: 33 LQRLYSEVHLLSTLNHDSIIRFYTSWIDVDHKTFNFITEMFTSGTLRE 80 >ref|XP_021810591.1| probable serine/threonine-protein kinase WNK4 isoform X1 [Prunus avium] Length = 585 Score = 89.7 bits (221), Expect = 6e-18 Identities = 42/48 (87%), Positives = 46/48 (95%) Frame = +2 Query: 2 LQRLYSEVHLLSTLDHDSIIRFYTSWIDVENRKLNFITEMFTSGTLRE 145 LQRLYSEVHLLSTL+HDSIIRFYTSWIDV+++ NFITEMFTSGTLRE Sbjct: 62 LQRLYSEVHLLSTLNHDSIIRFYTSWIDVDHKTFNFITEMFTSGTLRE 109 >ref|XP_007207424.2| probable serine/threonine-protein kinase WNK4 isoform X1 [Prunus persica] gb|ONH99672.1| hypothetical protein PRUPE_6G042600 [Prunus persica] Length = 586 Score = 89.7 bits (221), Expect = 6e-18 Identities = 42/48 (87%), Positives = 46/48 (95%) Frame = +2 Query: 2 LQRLYSEVHLLSTLDHDSIIRFYTSWIDVENRKLNFITEMFTSGTLRE 145 LQRLYSEVHLLSTL+HDSIIRFYTSWIDV+++ NFITEMFTSGTLRE Sbjct: 62 LQRLYSEVHLLSTLNHDSIIRFYTSWIDVDHKTFNFITEMFTSGTLRE 109 >ref|XP_008242759.1| PREDICTED: probable serine/threonine-protein kinase WNK4 isoform X1 [Prunus mume] Length = 586 Score = 89.7 bits (221), Expect = 6e-18 Identities = 42/48 (87%), Positives = 46/48 (95%) Frame = +2 Query: 2 LQRLYSEVHLLSTLDHDSIIRFYTSWIDVENRKLNFITEMFTSGTLRE 145 LQRLYSEVHLLSTL+HDSIIRFYTSWIDV+++ NFITEMFTSGTLRE Sbjct: 62 LQRLYSEVHLLSTLNHDSIIRFYTSWIDVDHKTFNFITEMFTSGTLRE 109 >gb|EYU36911.1| hypothetical protein MIMGU_mgv1a003239mg [Erythranthe guttata] Length = 597 Score = 89.7 bits (221), Expect = 6e-18 Identities = 42/48 (87%), Positives = 45/48 (93%) Frame = +2 Query: 2 LQRLYSEVHLLSTLDHDSIIRFYTSWIDVENRKLNFITEMFTSGTLRE 145 LQR+YSEVHLLSTLDHDSIIRF+TSW+DV NR NFITEMFTSGTLRE Sbjct: 72 LQRVYSEVHLLSTLDHDSIIRFHTSWVDVGNRTFNFITEMFTSGTLRE 119 >ref|XP_004294736.1| PREDICTED: probable serine/threonine-protein kinase WNK4 [Fragaria vesca subsp. vesca] Length = 602 Score = 89.7 bits (221), Expect = 6e-18 Identities = 42/48 (87%), Positives = 46/48 (95%) Frame = +2 Query: 2 LQRLYSEVHLLSTLDHDSIIRFYTSWIDVENRKLNFITEMFTSGTLRE 145 LQRLYSEVHLLSTL+HDSIIRFYTSWIDV+++ NFITEMFTSGTLRE Sbjct: 62 LQRLYSEVHLLSTLNHDSIIRFYTSWIDVDHKTFNFITEMFTSGTLRE 109 >ref|XP_012838103.1| PREDICTED: probable serine/threonine-protein kinase WNK4 [Erythranthe guttata] Length = 616 Score = 89.7 bits (221), Expect = 6e-18 Identities = 42/48 (87%), Positives = 45/48 (93%) Frame = +2 Query: 2 LQRLYSEVHLLSTLDHDSIIRFYTSWIDVENRKLNFITEMFTSGTLRE 145 LQR+YSEVHLLSTLDHDSIIRF+TSW+DV NR NFITEMFTSGTLRE Sbjct: 91 LQRVYSEVHLLSTLDHDSIIRFHTSWVDVGNRTFNFITEMFTSGTLRE 138