BLASTX nr result
ID: Rehmannia30_contig00026601
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00026601 (497 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZV50897.1| hypothetical protein F511_10468 [Dorcoceras hygro... 61 7e-08 ref|XP_017248416.1| PREDICTED: leucine-rich repeat receptor-like... 60 1e-07 dbj|GAV69423.1| LRRNT_2 domain-containing protein/LRR_4 domain-c... 60 3e-07 ref|XP_019259753.1| PREDICTED: receptor-like protein 12 [Nicotia... 59 6e-07 ref|XP_016506233.1| PREDICTED: receptor-like protein 12 [Nicotia... 59 6e-07 ref|XP_004290243.1| PREDICTED: leucine-rich repeat receptor-like... 59 6e-07 emb|CDP20127.1| unnamed protein product [Coffea canephora] 58 1e-06 ref|XP_021903319.1| MDIS1-interacting receptor like kinase 2-lik... 58 1e-06 ref|XP_019151818.1| PREDICTED: MDIS1-interacting receptor like k... 57 2e-06 gb|PIA29860.1| hypothetical protein AQUCO_05800144v1 [Aquilegia ... 57 2e-06 gb|PIA29853.1| hypothetical protein AQUCO_05800137v1 [Aquilegia ... 57 2e-06 gb|PIA29854.1| hypothetical protein AQUCO_05800138v1 [Aquilegia ... 57 2e-06 ref|XP_019055153.1| PREDICTED: MDIS1-interacting receptor like k... 57 2e-06 ref|XP_016444457.1| PREDICTED: receptor-like protein 12 isoform ... 57 3e-06 ref|XP_009773345.1| PREDICTED: receptor-like protein 12 [Nicotia... 57 3e-06 gb|PHU27194.1| hypothetical protein BC332_05526 [Capsicum chinense] 57 3e-06 gb|PHT56675.1| hypothetical protein CQW23_05161 [Capsicum baccatum] 57 3e-06 ref|XP_016560771.1| PREDICTED: probably inactive leucine-rich re... 57 3e-06 ref|XP_010270144.1| PREDICTED: DNA-damage-repair/toleration prot... 57 3e-06 gb|PIN11616.1| Leucine-rich repeat (LRR) protein associated with... 57 3e-06 >gb|KZV50897.1| hypothetical protein F511_10468 [Dorcoceras hygrometricum] Length = 447 Score = 61.2 bits (147), Expect = 7e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 98 ASAARCHVDDETGLLSFKSGITSDPSGMLTSW 3 ASAARCHVDDETGLL FKSGI +DPSG+L+SW Sbjct: 28 ASAARCHVDDETGLLDFKSGIRADPSGILSSW 59 >ref|XP_017248416.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PXL1 [Daucus carota subsp. sativus] gb|KZM96660.1| hypothetical protein DCAR_015978 [Daucus carota subsp. sativus] Length = 454 Score = 60.5 bits (145), Expect = 1e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 95 SAARCHVDDETGLLSFKSGITSDPSGMLTSW 3 ++A CHVDDE+GLLSFKSGITSDPSG+LTSW Sbjct: 22 TSAACHVDDESGLLSFKSGITSDPSGLLTSW 52 >dbj|GAV69423.1| LRRNT_2 domain-containing protein/LRR_4 domain-containing protein/LRR_6 domain-containing protein/LRR_8 domain-containing protein [Cephalotus follicularis] Length = 481 Score = 59.7 bits (143), Expect = 3e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 95 SAARCHVDDETGLLSFKSGITSDPSGMLTSW 3 S+A CHVDDETGLL FKSGIT DPSGML+SW Sbjct: 27 SSATCHVDDETGLLGFKSGITQDPSGMLSSW 57 >ref|XP_019259753.1| PREDICTED: receptor-like protein 12 [Nicotiana attenuata] gb|OIT39635.1| Putative inactive leucine-rich repeat receptor-like protein kinase [Nicotiana attenuata] Length = 473 Score = 58.5 bits (140), Expect = 6e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 92 AARCHVDDETGLLSFKSGITSDPSGMLTSW 3 AA+CHVDDE GLL FKSGITSDPSG+L SW Sbjct: 22 AAKCHVDDEAGLLGFKSGITSDPSGLLASW 51 >ref|XP_016506233.1| PREDICTED: receptor-like protein 12 [Nicotiana tabacum] Length = 473 Score = 58.5 bits (140), Expect = 6e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 92 AARCHVDDETGLLSFKSGITSDPSGMLTSW 3 AA+CHVDDE GLL FKSGITSDPSG+L SW Sbjct: 22 AAKCHVDDEAGLLGFKSGITSDPSGLLASW 51 >ref|XP_004290243.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein kinase BAM3 [Fragaria vesca subsp. vesca] Length = 479 Score = 58.5 bits (140), Expect = 6e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 95 SAARCHVDDETGLLSFKSGITSDPSGMLTSW 3 ++A CHVDDETGLL+FKSGIT+DPS MLTSW Sbjct: 25 TSAACHVDDETGLLAFKSGITADPSNMLTSW 55 >emb|CDP20127.1| unnamed protein product [Coffea canephora] Length = 481 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -1 Query: 98 ASAARCHVDDETGLLSFKSGITSDPSGMLTSW 3 A AA+CH DDE GLL+FKSGIT+DPSGML SW Sbjct: 27 AEAAKCHPDDEAGLLAFKSGITADPSGMLQSW 58 >ref|XP_021903319.1| MDIS1-interacting receptor like kinase 2-like [Carica papaya] Length = 499 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -1 Query: 95 SAARCHVDDETGLLSFKSGITSDPSGMLTSW 3 S+A CHVDDE GLL FKSGIT DPSGML+SW Sbjct: 44 SSAACHVDDEAGLLGFKSGITQDPSGMLSSW 74 >ref|XP_019151818.1| PREDICTED: MDIS1-interacting receptor like kinase 2-like [Ipomoea nil] Length = 477 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -1 Query: 98 ASAARCHVDDETGLLSFKSGITSDPSGMLTSW 3 A+AA CH DDE GLL FKSGITSDPSG+L+SW Sbjct: 21 ATAASCHPDDEAGLLGFKSGITSDPSGLLSSW 52 >gb|PIA29860.1| hypothetical protein AQUCO_05800144v1 [Aquilegia coerulea] Length = 481 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = -1 Query: 89 ARCHVDDETGLLSFKSGITSDPSGMLTSW 3 A+CH+DDETGLL+FKSGIT DPSG+L+SW Sbjct: 27 AKCHIDDETGLLAFKSGITQDPSGILSSW 55 >gb|PIA29853.1| hypothetical protein AQUCO_05800137v1 [Aquilegia coerulea] Length = 310 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -1 Query: 89 ARCHVDDETGLLSFKSGITSDPSGMLTSW 3 A+CHVDDE GLL+FKSGIT DPSGML+SW Sbjct: 18 AKCHVDDEAGLLAFKSGITRDPSGMLSSW 46 >gb|PIA29854.1| hypothetical protein AQUCO_05800138v1 [Aquilegia coerulea] Length = 317 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -1 Query: 89 ARCHVDDETGLLSFKSGITSDPSGMLTSW 3 A+CHVDDE GLL+FKSGIT DPSGML+SW Sbjct: 29 AKCHVDDEAGLLAFKSGITRDPSGMLSSW 57 >ref|XP_019055153.1| PREDICTED: MDIS1-interacting receptor like kinase 2-like [Nelumbo nucifera] Length = 469 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -1 Query: 95 SAARCHVDDETGLLSFKSGITSDPSGMLTSW 3 +AA+CH DDE GLL FKSGIT DPSGML SW Sbjct: 24 NAAKCHADDEAGLLGFKSGITDDPSGMLNSW 54 >ref|XP_016444457.1| PREDICTED: receptor-like protein 12 isoform X1 [Nicotiana tabacum] ref|XP_016444458.1| PREDICTED: receptor-like protein 12 isoform X2 [Nicotiana tabacum] Length = 473 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -1 Query: 92 AARCHVDDETGLLSFKSGITSDPSGMLTSW 3 AA+CHVDDE GLL FKSGI SDPSG+L+SW Sbjct: 22 AAKCHVDDEAGLLGFKSGIKSDPSGLLSSW 51 >ref|XP_009773345.1| PREDICTED: receptor-like protein 12 [Nicotiana sylvestris] Length = 473 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -1 Query: 92 AARCHVDDETGLLSFKSGITSDPSGMLTSW 3 AA+CHVDDE GLL FKSGI SDPSG+L+SW Sbjct: 22 AAKCHVDDEAGLLGFKSGIKSDPSGLLSSW 51 >gb|PHU27194.1| hypothetical protein BC332_05526 [Capsicum chinense] Length = 476 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -1 Query: 92 AARCHVDDETGLLSFKSGITSDPSGMLTSW 3 AA CHVDDE+GLL FKSGITSDPSG+L +W Sbjct: 25 AANCHVDDESGLLGFKSGITSDPSGILANW 54 >gb|PHT56675.1| hypothetical protein CQW23_05161 [Capsicum baccatum] Length = 476 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -1 Query: 92 AARCHVDDETGLLSFKSGITSDPSGMLTSW 3 AA CHVDDE+GLL FKSGITSDPSG+L +W Sbjct: 25 AANCHVDDESGLLGFKSGITSDPSGILANW 54 >ref|XP_016560771.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 [Capsicum annuum] gb|PHT91360.1| hypothetical protein T459_06473 [Capsicum annuum] Length = 476 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -1 Query: 92 AARCHVDDETGLLSFKSGITSDPSGMLTSW 3 AA CHVDDE+GLL FKSGITSDPSG+L +W Sbjct: 25 AANCHVDDESGLLGFKSGITSDPSGILANW 54 >ref|XP_010270144.1| PREDICTED: DNA-damage-repair/toleration protein DRT100-like [Nelumbo nucifera] Length = 478 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -1 Query: 95 SAARCHVDDETGLLSFKSGITSDPSGMLTSW 3 +AA+CH DDE GLL FKSGIT DPSG+LTSW Sbjct: 22 NAAKCHPDDEAGLLGFKSGITEDPSGILTSW 52 >gb|PIN11616.1| Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [Handroanthus impetiginosus] Length = 480 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -1 Query: 98 ASAARCHVDDETGLLSFKSGITSDPSGMLTSW 3 AS+A CH+DDETGLL FKSGI +DPSG L+SW Sbjct: 25 ASSATCHIDDETGLLGFKSGIRADPSGKLSSW 56