BLASTX nr result
ID: Rehmannia30_contig00026571
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00026571 (690 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022150918.1| uncharacterized protein LOC111018954 [Momord... 50 6e-06 >ref|XP_022150918.1| uncharacterized protein LOC111018954 [Momordica charantia] Length = 1138 Score = 50.4 bits (119), Expect(2) = 6e-06 Identities = 38/109 (34%), Positives = 49/109 (44%), Gaps = 11/109 (10%) Frame = +3 Query: 93 IRQNLQWHSGAIKSQTFGIGRAKKEVFQYVVDTAKRRICDDQSCFKL-----------VA 239 I+ + H K++ F IG KEV V A+ C SCF+L A Sbjct: 561 IKDRVWKHLQGWKAKLFSIGG--KEVLIKAV--AQAIPCYTMSCFRLPKRLIREFHHITA 616 Query: 240 HFWWGSSSEGHGKILTVNWKAKAWPRQEGGLGFWDIDALMILFWKKQIW 386 FWWGSS E KI V W + P+ EGG+GF D++ KQ W Sbjct: 617 RFWWGSSKEDK-KIHWVAWNSLYLPKCEGGMGFRDLELFNKALLAKQCW 664 Score = 28.1 bits (61), Expect(2) = 6e-06 Identities = 11/41 (26%), Positives = 24/41 (58%) Frame = +1 Query: 388 RLIEQPNLLVSNILKEYFFR*VLFQRIQFAGYDSFLSLSLM 510 R++ PN ++S +LK +F+ F + +G S++ S++ Sbjct: 665 RILNHPNSMLSRVLKGRYFKDCSFMEAKISGNPSYIWRSIL 705