BLASTX nr result
ID: Rehmannia30_contig00026526
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00026526 (772 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011092232.1| nuclear pore complex protein NUP160 [Sesamum... 98 2e-19 gb|EYU35396.1| hypothetical protein MIMGU_mgv1a000187mg [Erythra... 92 2e-17 ref|XP_012839848.1| PREDICTED: nuclear pore complex protein NUP1... 92 2e-17 ref|XP_022868070.1| nuclear pore complex protein NUP160 [Olea eu... 92 2e-17 ref|XP_015169438.1| PREDICTED: nuclear pore complex protein NUP1... 89 4e-16 ref|XP_015062036.1| PREDICTED: nuclear pore complex protein NUP1... 89 4e-16 ref|XP_016470642.1| PREDICTED: nuclear pore complex protein NUP1... 89 4e-16 ref|XP_009603527.1| PREDICTED: nuclear pore complex protein NUP1... 89 4e-16 ref|XP_015062035.1| PREDICTED: nuclear pore complex protein NUP1... 89 4e-16 ref|XP_010314086.1| PREDICTED: nuclear pore complex protein NUP1... 89 4e-16 ref|XP_009603526.1| PREDICTED: nuclear pore complex protein NUP1... 89 4e-16 ref|XP_006358491.1| PREDICTED: nuclear pore complex protein NUP1... 89 4e-16 ref|XP_006358490.1| PREDICTED: nuclear pore complex protein NUP1... 89 4e-16 ref|XP_015169436.1| PREDICTED: nuclear pore complex protein NUP1... 89 4e-16 ref|XP_015169435.1| PREDICTED: nuclear pore complex protein NUP1... 89 4e-16 gb|PHT41470.1| hypothetical protein CQW23_20324 [Capsicum baccatum] 87 9e-16 ref|XP_008358268.1| PREDICTED: nuclear pore complex protein NUP1... 80 2e-15 gb|PHT62215.1| Nuclear pore complex protein [Capsicum annuum] 86 4e-15 gb|PHU10185.1| hypothetical protein BC332_22045 [Capsicum chinense] 86 4e-15 ref|XP_016538894.1| PREDICTED: nuclear pore complex protein NUP1... 86 4e-15 >ref|XP_011092232.1| nuclear pore complex protein NUP160 [Sesamum indicum] Length = 1506 Score = 98.2 bits (243), Expect = 2e-19 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = +3 Query: 6 EHMETLASVRPADVIRRKRPFAVWFPYTSVERLWCLLEESIRLGHRIDQSE 158 E+METLASVRPADVIRRKR FAVWFPYTSVERLWCLL+ESI+LGHRIDQ + Sbjct: 1427 EYMETLASVRPADVIRRKRSFAVWFPYTSVERLWCLLQESIKLGHRIDQCD 1477 >gb|EYU35396.1| hypothetical protein MIMGU_mgv1a000187mg [Erythranthe guttata] Length = 1468 Score = 92.4 bits (228), Expect = 2e-17 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = +3 Query: 3 IEHMETLASVRPADVIRRKRPFAVWFPYTSVERLWCLLEESIRLGHRIDQ 152 IE+ ET +++RPADVIRRKRPFA WFPYTSVERLWCLLEESI+ GHRIDQ Sbjct: 1388 IEYTETFSALRPADVIRRKRPFAAWFPYTSVERLWCLLEESIKSGHRIDQ 1437 >ref|XP_012839848.1| PREDICTED: nuclear pore complex protein NUP160 [Erythranthe guttata] Length = 1502 Score = 92.4 bits (228), Expect = 2e-17 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = +3 Query: 3 IEHMETLASVRPADVIRRKRPFAVWFPYTSVERLWCLLEESIRLGHRIDQ 152 IE+ ET +++RPADVIRRKRPFA WFPYTSVERLWCLLEESI+ GHRIDQ Sbjct: 1422 IEYTETFSALRPADVIRRKRPFAAWFPYTSVERLWCLLEESIKSGHRIDQ 1471 >ref|XP_022868070.1| nuclear pore complex protein NUP160 [Olea europaea var. sylvestris] Length = 1080 Score = 92.0 bits (227), Expect = 2e-17 Identities = 44/52 (84%), Positives = 49/52 (94%) Frame = +3 Query: 3 IEHMETLASVRPADVIRRKRPFAVWFPYTSVERLWCLLEESIRLGHRIDQSE 158 IE++E+LAS RPADVIRRK FAVWFPYT++ERLWCLLEESIRLGHRIDQSE Sbjct: 996 IEYIESLAS-RPADVIRRKAQFAVWFPYTTIERLWCLLEESIRLGHRIDQSE 1046 >ref|XP_015169438.1| PREDICTED: nuclear pore complex protein NUP160 isoform X5 [Solanum tuberosum] Length = 1336 Score = 88.6 bits (218), Expect = 4e-16 Identities = 36/52 (69%), Positives = 48/52 (92%) Frame = +3 Query: 3 IEHMETLASVRPADVIRRKRPFAVWFPYTSVERLWCLLEESIRLGHRIDQSE 158 +E++E+ AS+RPAD+IRRKRPFAVWFPY+ +ERLWC L++SI+LGH +DQSE Sbjct: 1256 LEYIESFASLRPADIIRRKRPFAVWFPYSLIERLWCQLQQSIKLGHMVDQSE 1307 >ref|XP_015062036.1| PREDICTED: nuclear pore complex protein NUP160 isoform X2 [Solanum pennellii] Length = 1476 Score = 88.6 bits (218), Expect = 4e-16 Identities = 36/52 (69%), Positives = 48/52 (92%) Frame = +3 Query: 3 IEHMETLASVRPADVIRRKRPFAVWFPYTSVERLWCLLEESIRLGHRIDQSE 158 +E++E+ AS+RPAD+IRRKRPFAVWFPY+ +ERLWC L++SI+LGH +DQSE Sbjct: 1396 LEYIESFASLRPADIIRRKRPFAVWFPYSLIERLWCQLQQSIKLGHMVDQSE 1447 >ref|XP_016470642.1| PREDICTED: nuclear pore complex protein NUP160 [Nicotiana tabacum] Length = 1486 Score = 88.6 bits (218), Expect = 4e-16 Identities = 36/52 (69%), Positives = 48/52 (92%) Frame = +3 Query: 3 IEHMETLASVRPADVIRRKRPFAVWFPYTSVERLWCLLEESIRLGHRIDQSE 158 +E++E+ AS+RPAD+IRRKRPFAVWFPY+ +ERLWC L++SI+LGH +DQSE Sbjct: 1406 LEYIESFASLRPADIIRRKRPFAVWFPYSLIERLWCQLQQSIKLGHMVDQSE 1457 >ref|XP_009603527.1| PREDICTED: nuclear pore complex protein NUP160 isoform X2 [Nicotiana tomentosiformis] Length = 1486 Score = 88.6 bits (218), Expect = 4e-16 Identities = 36/52 (69%), Positives = 48/52 (92%) Frame = +3 Query: 3 IEHMETLASVRPADVIRRKRPFAVWFPYTSVERLWCLLEESIRLGHRIDQSE 158 +E++E+ AS+RPAD+IRRKRPFAVWFPY+ +ERLWC L++SI+LGH +DQSE Sbjct: 1406 LEYIESFASLRPADIIRRKRPFAVWFPYSLIERLWCQLQQSIKLGHMVDQSE 1457 >ref|XP_015062035.1| PREDICTED: nuclear pore complex protein NUP160 isoform X1 [Solanum pennellii] Length = 1487 Score = 88.6 bits (218), Expect = 4e-16 Identities = 36/52 (69%), Positives = 48/52 (92%) Frame = +3 Query: 3 IEHMETLASVRPADVIRRKRPFAVWFPYTSVERLWCLLEESIRLGHRIDQSE 158 +E++E+ AS+RPAD+IRRKRPFAVWFPY+ +ERLWC L++SI+LGH +DQSE Sbjct: 1407 LEYIESFASLRPADIIRRKRPFAVWFPYSLIERLWCQLQQSIKLGHMVDQSE 1458 >ref|XP_010314086.1| PREDICTED: nuclear pore complex protein NUP160 isoform X1 [Solanum lycopersicum] Length = 1487 Score = 88.6 bits (218), Expect = 4e-16 Identities = 36/52 (69%), Positives = 48/52 (92%) Frame = +3 Query: 3 IEHMETLASVRPADVIRRKRPFAVWFPYTSVERLWCLLEESIRLGHRIDQSE 158 +E++E+ AS+RPAD+IRRKRPFAVWFPY+ +ERLWC L++SI+LGH +DQSE Sbjct: 1407 LEYIESFASLRPADIIRRKRPFAVWFPYSLIERLWCQLQQSIKLGHMVDQSE 1458 >ref|XP_009603526.1| PREDICTED: nuclear pore complex protein NUP160 isoform X1 [Nicotiana tomentosiformis] Length = 1488 Score = 88.6 bits (218), Expect = 4e-16 Identities = 36/52 (69%), Positives = 48/52 (92%) Frame = +3 Query: 3 IEHMETLASVRPADVIRRKRPFAVWFPYTSVERLWCLLEESIRLGHRIDQSE 158 +E++E+ AS+RPAD+IRRKRPFAVWFPY+ +ERLWC L++SI+LGH +DQSE Sbjct: 1408 LEYIESFASLRPADIIRRKRPFAVWFPYSLIERLWCQLQQSIKLGHMVDQSE 1459 >ref|XP_006358491.1| PREDICTED: nuclear pore complex protein NUP160 isoform X4 [Solanum tuberosum] Length = 1490 Score = 88.6 bits (218), Expect = 4e-16 Identities = 36/52 (69%), Positives = 48/52 (92%) Frame = +3 Query: 3 IEHMETLASVRPADVIRRKRPFAVWFPYTSVERLWCLLEESIRLGHRIDQSE 158 +E++E+ AS+RPAD+IRRKRPFAVWFPY+ +ERLWC L++SI+LGH +DQSE Sbjct: 1410 LEYIESFASLRPADIIRRKRPFAVWFPYSLIERLWCQLQQSIKLGHMVDQSE 1461 >ref|XP_006358490.1| PREDICTED: nuclear pore complex protein NUP160 isoform X3 [Solanum tuberosum] Length = 1492 Score = 88.6 bits (218), Expect = 4e-16 Identities = 36/52 (69%), Positives = 48/52 (92%) Frame = +3 Query: 3 IEHMETLASVRPADVIRRKRPFAVWFPYTSVERLWCLLEESIRLGHRIDQSE 158 +E++E+ AS+RPAD+IRRKRPFAVWFPY+ +ERLWC L++SI+LGH +DQSE Sbjct: 1412 LEYIESFASLRPADIIRRKRPFAVWFPYSLIERLWCQLQQSIKLGHMVDQSE 1463 >ref|XP_015169436.1| PREDICTED: nuclear pore complex protein NUP160 isoform X2 [Solanum tuberosum] Length = 1494 Score = 88.6 bits (218), Expect = 4e-16 Identities = 36/52 (69%), Positives = 48/52 (92%) Frame = +3 Query: 3 IEHMETLASVRPADVIRRKRPFAVWFPYTSVERLWCLLEESIRLGHRIDQSE 158 +E++E+ AS+RPAD+IRRKRPFAVWFPY+ +ERLWC L++SI+LGH +DQSE Sbjct: 1414 LEYIESFASLRPADIIRRKRPFAVWFPYSLIERLWCQLQQSIKLGHMVDQSE 1465 >ref|XP_015169435.1| PREDICTED: nuclear pore complex protein NUP160 isoform X1 [Solanum tuberosum] Length = 1496 Score = 88.6 bits (218), Expect = 4e-16 Identities = 36/52 (69%), Positives = 48/52 (92%) Frame = +3 Query: 3 IEHMETLASVRPADVIRRKRPFAVWFPYTSVERLWCLLEESIRLGHRIDQSE 158 +E++E+ AS+RPAD+IRRKRPFAVWFPY+ +ERLWC L++SI+LGH +DQSE Sbjct: 1416 LEYIESFASLRPADIIRRKRPFAVWFPYSLIERLWCQLQQSIKLGHMVDQSE 1467 >gb|PHT41470.1| hypothetical protein CQW23_20324 [Capsicum baccatum] Length = 1432 Score = 87.4 bits (215), Expect = 9e-16 Identities = 35/52 (67%), Positives = 48/52 (92%) Frame = +3 Query: 3 IEHMETLASVRPADVIRRKRPFAVWFPYTSVERLWCLLEESIRLGHRIDQSE 158 +E++E+ AS+RPAD+IRRK+PFAVWFPY+ +ERLWC L++SI+LGH +DQSE Sbjct: 1352 LEYIESFASLRPADIIRRKKPFAVWFPYSLIERLWCQLQQSIKLGHMVDQSE 1403 >ref|XP_008358268.1| PREDICTED: nuclear pore complex protein NUP160-like [Malus domestica] Length = 109 Score = 80.1 bits (196), Expect = 2e-15 Identities = 33/50 (66%), Positives = 43/50 (86%) Frame = +3 Query: 3 IEHMETLASVRPADVIRRKRPFAVWFPYTSVERLWCLLEESIRLGHRIDQ 152 +E++ LAS+RPAD+++RKRPFAVWFPYT+V+RLWC LEE I GH +DQ Sbjct: 29 LEYIGPLASMRPADIVKRKRPFAVWFPYTAVQRLWCQLEELISSGHMVDQ 78 >gb|PHT62215.1| Nuclear pore complex protein [Capsicum annuum] Length = 969 Score = 85.5 bits (210), Expect = 4e-15 Identities = 35/52 (67%), Positives = 47/52 (90%) Frame = +3 Query: 3 IEHMETLASVRPADVIRRKRPFAVWFPYTSVERLWCLLEESIRLGHRIDQSE 158 +E++E+ AS+RPAD+IRRK+PFAVWFPY+ +ERLWC L+ SI+LGH +DQSE Sbjct: 889 LEYIESFASLRPADIIRRKKPFAVWFPYSLIERLWCQLQLSIKLGHMVDQSE 940 >gb|PHU10185.1| hypothetical protein BC332_22045 [Capsicum chinense] Length = 1426 Score = 85.5 bits (210), Expect = 4e-15 Identities = 35/52 (67%), Positives = 47/52 (90%) Frame = +3 Query: 3 IEHMETLASVRPADVIRRKRPFAVWFPYTSVERLWCLLEESIRLGHRIDQSE 158 +E++E+ AS+RPAD+IRRK+PFAVWFPY+ +ERLWC L+ SI+LGH +DQSE Sbjct: 1346 LEYIESFASLRPADIIRRKKPFAVWFPYSLIERLWCQLQLSIKLGHMVDQSE 1397 >ref|XP_016538894.1| PREDICTED: nuclear pore complex protein NUP160 isoform X2 [Capsicum annuum] Length = 1483 Score = 85.5 bits (210), Expect = 4e-15 Identities = 35/52 (67%), Positives = 47/52 (90%) Frame = +3 Query: 3 IEHMETLASVRPADVIRRKRPFAVWFPYTSVERLWCLLEESIRLGHRIDQSE 158 +E++E+ AS+RPAD+IRRK+PFAVWFPY+ +ERLWC L+ SI+LGH +DQSE Sbjct: 1403 LEYIESFASLRPADIIRRKKPFAVWFPYSLIERLWCQLQLSIKLGHMVDQSE 1454