BLASTX nr result
ID: Rehmannia30_contig00026457
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00026457 (647 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN17420.1| Serine/threonine protein kinase [Handroanthus imp... 63 6e-08 gb|PIN18797.1| Serine/threonine protein kinase [Handroanthus imp... 63 8e-08 gb|PIN03841.1| Leucine-rich repeat protein [Handroanthus impetig... 62 1e-07 gb|EYU36356.1| hypothetical protein MIMGU_mgv1a018150mg, partial... 58 3e-06 ref|XP_012838211.1| PREDICTED: uncharacterized protein LOC105958... 58 3e-06 >gb|PIN17420.1| Serine/threonine protein kinase [Handroanthus impetiginosus] Length = 1014 Score = 63.2 bits (152), Expect = 6e-08 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 120 SYHMLEASPLSITTDKEALISFKSQIFIEHPNNPLSTWDQ 1 S +L +SPLSI TDKEALISFKSQI IE PNNPL+TWDQ Sbjct: 22 SLQILLSSPLSIATDKEALISFKSQISIELPNNPLTTWDQ 61 >gb|PIN18797.1| Serine/threonine protein kinase [Handroanthus impetiginosus] Length = 1013 Score = 62.8 bits (151), Expect = 8e-08 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -3 Query: 120 SYHMLEASPLSITTDKEALISFKSQIFIEHPNNPLSTWDQ 1 S +L +SPLSI TDKEALISFKSQI +E PNNPL+TWDQ Sbjct: 22 SLQILLSSPLSIATDKEALISFKSQISVELPNNPLTTWDQ 61 >gb|PIN03841.1| Leucine-rich repeat protein [Handroanthus impetiginosus] Length = 743 Score = 62.0 bits (149), Expect = 1e-07 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -3 Query: 120 SYHMLEASPLSITTDKEALISFKSQIFIEHPNNPLSTWDQ 1 S+ +L++S L+ITTDKEALIS KSQI IE PNNPL+TWDQ Sbjct: 22 SFQILQSSQLNITTDKEALISLKSQISIELPNNPLTTWDQ 61 >gb|EYU36356.1| hypothetical protein MIMGU_mgv1a018150mg, partial [Erythranthe guttata] Length = 838 Score = 58.2 bits (139), Expect = 3e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -3 Query: 102 ASPLSITTDKEALISFKSQIFIEHPNNPLSTWDQ 1 +SP SITTDKEAL+S KSQ +E PNNPLSTWDQ Sbjct: 10 SSPFSITTDKEALLSLKSQFHVEIPNNPLSTWDQ 43 >ref|XP_012838211.1| PREDICTED: uncharacterized protein LOC105958753 [Erythranthe guttata] Length = 2056 Score = 58.2 bits (139), Expect = 3e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -3 Query: 102 ASPLSITTDKEALISFKSQIFIEHPNNPLSTWDQ 1 +SP SITTDKEAL+S KSQ +E PNNPLSTWDQ Sbjct: 30 SSPFSITTDKEALLSLKSQFHVEIPNNPLSTWDQ 63