BLASTX nr result
ID: Rehmannia30_contig00026247
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00026247 (428 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011094448.1| pentatricopeptide repeat-containing protein ... 92 1e-18 gb|PIN04248.1| hypothetical protein CDL12_23217 [Handroanthus im... 88 5e-18 gb|EYU41565.1| hypothetical protein MIMGU_mgv1a026878mg, partial... 87 6e-17 ref|XP_012831869.1| PREDICTED: pentatricopeptide repeat-containi... 87 6e-17 ref|XP_004305376.2| PREDICTED: pentatricopeptide repeat-containi... 86 8e-17 ref|XP_024189064.1| pentatricopeptide repeat-containing protein ... 86 1e-16 ref|XP_021621105.1| pentatricopeptide repeat-containing protein ... 86 1e-16 ref|XP_015953262.1| pentatricopeptide repeat-containing protein ... 85 2e-16 ref|XP_016188447.1| pentatricopeptide repeat-containing protein ... 85 2e-16 ref|XP_015898557.1| PREDICTED: pentatricopeptide repeat-containi... 85 2e-16 ref|XP_020973959.1| pentatricopeptide repeat-containing protein ... 85 2e-16 ref|XP_022888704.1| pentatricopeptide repeat-containing protein ... 84 4e-16 ref|XP_023884971.1| pentatricopeptide repeat-containing protein ... 84 4e-16 ref|XP_023885306.1| pentatricopeptide repeat-containing protein ... 84 4e-16 ref|XP_023885305.1| pentatricopeptide repeat-containing protein ... 84 4e-16 ref|XP_015580518.1| PREDICTED: pentatricopeptide repeat-containi... 84 5e-16 ref|XP_016687474.1| PREDICTED: pentatricopeptide repeat-containi... 84 7e-16 ref|XP_017617867.1| PREDICTED: pentatricopeptide repeat-containi... 84 7e-16 ref|XP_012468229.1| PREDICTED: pentatricopeptide repeat-containi... 84 7e-16 gb|PPR92500.1| hypothetical protein GOBAR_AA28167 [Gossypium bar... 84 7e-16 >ref|XP_011094448.1| pentatricopeptide repeat-containing protein At5g03800 [Sesamum indicum] Length = 903 Score = 91.7 bits (226), Expect = 1e-18 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = +1 Query: 1 CGDCHTFLKYVSVVTKREIHVRDASGFHIFANGECSCKDYW 123 CGDCHTF KYVSVVTKREIHVRD+SGFH FANGECSCKDYW Sbjct: 863 CGDCHTFFKYVSVVTKREIHVRDSSGFHCFANGECSCKDYW 903 >gb|PIN04248.1| hypothetical protein CDL12_23217 [Handroanthus impetiginosus] Length = 331 Score = 88.2 bits (217), Expect = 5e-18 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = +1 Query: 1 CGDCHTFLKYVSVVTKREIHVRDASGFHIFANGECSCKDYW 123 CGDCHTF KYVSVVTKREIHVRD+SGFH F NGECSC+DYW Sbjct: 291 CGDCHTFFKYVSVVTKREIHVRDSSGFHRFVNGECSCRDYW 331 >gb|EYU41565.1| hypothetical protein MIMGU_mgv1a026878mg, partial [Erythranthe guttata] Length = 722 Score = 86.7 bits (213), Expect = 6e-17 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = +1 Query: 1 CGDCHTFLKYVSVVTKREIHVRDASGFHIFANGECSCKDYW 123 CGDCHTFLKYV+VVTKREIHVRDASGFH FA+GECSC+D W Sbjct: 682 CGDCHTFLKYVTVVTKREIHVRDASGFHCFADGECSCRDNW 722 >ref|XP_012831869.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Erythranthe guttata] Length = 894 Score = 86.7 bits (213), Expect = 6e-17 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = +1 Query: 1 CGDCHTFLKYVSVVTKREIHVRDASGFHIFANGECSCKDYW 123 CGDCHTFLKYV+VVTKREIHVRDASGFH FA+GECSC+D W Sbjct: 854 CGDCHTFLKYVTVVTKREIHVRDASGFHCFADGECSCRDNW 894 >ref|XP_004305376.2| PREDICTED: pentatricopeptide repeat-containing protein At5g03800, partial [Fragaria vesca subsp. vesca] Length = 838 Score = 86.3 bits (212), Expect = 8e-17 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +1 Query: 1 CGDCHTFLKYVSVVTKREIHVRDASGFHIFANGECSCKDYW 123 CGDCHTFLKY+S+V KR IHVRDASGFH F+NG+CSCKDYW Sbjct: 798 CGDCHTFLKYLSIVAKRAIHVRDASGFHYFSNGQCSCKDYW 838 >ref|XP_024189064.1| pentatricopeptide repeat-containing protein At5g03800 [Rosa chinensis] gb|PRQ43733.1| putative DYW domain-containing protein [Rosa chinensis] Length = 883 Score = 85.9 bits (211), Expect = 1e-16 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +1 Query: 1 CGDCHTFLKYVSVVTKREIHVRDASGFHIFANGECSCKDYW 123 CGDCHTFLKY+SVV KR +HVRDASGFH F+NG+CSCKDYW Sbjct: 843 CGDCHTFLKYLSVVAKRALHVRDASGFHYFSNGQCSCKDYW 883 >ref|XP_021621105.1| pentatricopeptide repeat-containing protein At5g03800 [Manihot esculenta] gb|OAY42813.1| hypothetical protein MANES_08G017700 [Manihot esculenta] Length = 912 Score = 85.9 bits (211), Expect = 1e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +1 Query: 1 CGDCHTFLKYVSVVTKREIHVRDASGFHIFANGECSCKDYW 123 CGDCH+FLKYVSVVT+REI VRDASGFH F+NG+CSCKDYW Sbjct: 872 CGDCHSFLKYVSVVTRREIFVRDASGFHCFSNGQCSCKDYW 912 >ref|XP_015953262.1| pentatricopeptide repeat-containing protein At5g03800 [Arachis duranensis] Length = 885 Score = 85.1 bits (209), Expect = 2e-16 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = +1 Query: 1 CGDCHTFLKYVSVVTKREIHVRDASGFHIFANGECSCKDYW 123 CGDCHTFLKYVSVVTKR+I +RD+SGFH F+NG+CSCKDYW Sbjct: 845 CGDCHTFLKYVSVVTKRDIFLRDSSGFHCFSNGQCSCKDYW 885 >ref|XP_016188447.1| pentatricopeptide repeat-containing protein At5g03800 isoform X2 [Arachis ipaensis] ref|XP_020973960.1| pentatricopeptide repeat-containing protein At5g03800 isoform X2 [Arachis ipaensis] ref|XP_020973961.1| pentatricopeptide repeat-containing protein At5g03800 isoform X2 [Arachis ipaensis] ref|XP_020973962.1| pentatricopeptide repeat-containing protein At5g03800 isoform X2 [Arachis ipaensis] ref|XP_020973963.1| pentatricopeptide repeat-containing protein At5g03800 isoform X2 [Arachis ipaensis] Length = 888 Score = 85.1 bits (209), Expect = 2e-16 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = +1 Query: 1 CGDCHTFLKYVSVVTKREIHVRDASGFHIFANGECSCKDYW 123 CGDCHTFLKYVSVVTKR+I +RD+SGFH F+NG+CSCKDYW Sbjct: 848 CGDCHTFLKYVSVVTKRDIFLRDSSGFHCFSNGQCSCKDYW 888 >ref|XP_015898557.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Ziziphus jujuba] Length = 912 Score = 85.1 bits (209), Expect = 2e-16 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = +1 Query: 1 CGDCHTFLKYVSVVTKREIHVRDASGFHIFANGECSCKDYW 123 CGDCHTFLKYVS+VT+REI VRDASGFH F++G+CSCKDYW Sbjct: 872 CGDCHTFLKYVSIVTRREIFVRDASGFHCFSSGQCSCKDYW 912 >ref|XP_020973959.1| pentatricopeptide repeat-containing protein At5g03800 isoform X1 [Arachis ipaensis] Length = 929 Score = 85.1 bits (209), Expect = 2e-16 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = +1 Query: 1 CGDCHTFLKYVSVVTKREIHVRDASGFHIFANGECSCKDYW 123 CGDCHTFLKYVSVVTKR+I +RD+SGFH F+NG+CSCKDYW Sbjct: 889 CGDCHTFLKYVSVVTKRDIFLRDSSGFHCFSNGQCSCKDYW 929 >ref|XP_022888704.1| pentatricopeptide repeat-containing protein At5g03800 [Olea europaea var. sylvestris] Length = 900 Score = 84.3 bits (207), Expect = 4e-16 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = +1 Query: 1 CGDCHTFLKYVSVVTKREIHVRDASGFHIFANGECSCKDYW 123 CGDCHTFLKYVS VTKR IHVRD SGFH F+NG CSCKDYW Sbjct: 860 CGDCHTFLKYVSTVTKRPIHVRDPSGFHYFSNGICSCKDYW 900 >ref|XP_023884971.1| pentatricopeptide repeat-containing protein At5g03800-like [Quercus suber] Length = 921 Score = 84.3 bits (207), Expect = 4e-16 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = +1 Query: 1 CGDCHTFLKYVSVVTKREIHVRDASGFHIFANGECSCKDYW 123 CGDCHTFLK+VSVVTKREI +RD+SGFH F+NG+CSCKDYW Sbjct: 881 CGDCHTFLKHVSVVTKREIFLRDSSGFHCFSNGQCSCKDYW 921 >ref|XP_023885306.1| pentatricopeptide repeat-containing protein At5g03800-like isoform X2 [Quercus suber] Length = 937 Score = 84.3 bits (207), Expect = 4e-16 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = +1 Query: 1 CGDCHTFLKYVSVVTKREIHVRDASGFHIFANGECSCKDYW 123 CGDCHTFLK+VSVVTKREI +RD+SGFH F+NG+CSCKDYW Sbjct: 897 CGDCHTFLKHVSVVTKREIFLRDSSGFHCFSNGQCSCKDYW 937 >ref|XP_023885305.1| pentatricopeptide repeat-containing protein At5g03800-like isoform X1 [Quercus suber] Length = 938 Score = 84.3 bits (207), Expect = 4e-16 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = +1 Query: 1 CGDCHTFLKYVSVVTKREIHVRDASGFHIFANGECSCKDYW 123 CGDCHTFLK+VSVVTKREI +RD+SGFH F+NG+CSCKDYW Sbjct: 897 CGDCHTFLKHVSVVTKREIFLRDSSGFHCFSNGQCSCKDYW 937 >ref|XP_015580518.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Ricinus communis] Length = 782 Score = 84.0 bits (206), Expect = 5e-16 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = +1 Query: 1 CGDCHTFLKYVSVVTKREIHVRDASGFHIFANGECSCKDYW 123 CGDCHTFLKYVS VTKREI VRD SGFH F+NG CSCKDYW Sbjct: 741 CGDCHTFLKYVSAVTKREIIVRDTSGFHCFSNGHCSCKDYW 781 >ref|XP_016687474.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Gossypium hirsutum] Length = 883 Score = 83.6 bits (205), Expect = 7e-16 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = +1 Query: 1 CGDCHTFLKYVSVVTKREIHVRDASGFHIFANGECSCKDYW 123 CGDCHTF+KYVS++TKREI VRDASGFH F NG+C CKDYW Sbjct: 843 CGDCHTFMKYVSIITKREILVRDASGFHCFRNGQCCCKDYW 883 >ref|XP_017617867.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Gossypium arboreum] Length = 885 Score = 83.6 bits (205), Expect = 7e-16 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = +1 Query: 1 CGDCHTFLKYVSVVTKREIHVRDASGFHIFANGECSCKDYW 123 CGDCHTF+KYVS++TKREI VRDASGFH F NG+C CKDYW Sbjct: 845 CGDCHTFMKYVSIITKREILVRDASGFHCFRNGQCCCKDYW 885 >ref|XP_012468229.1| PREDICTED: pentatricopeptide repeat-containing protein At5g03800 [Gossypium raimondii] gb|KJB16718.1| hypothetical protein B456_002G244700 [Gossypium raimondii] Length = 885 Score = 83.6 bits (205), Expect = 7e-16 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = +1 Query: 1 CGDCHTFLKYVSVVTKREIHVRDASGFHIFANGECSCKDYW 123 CGDCHTF+KYVS++TKREI VRDASGFH F NG+C CKDYW Sbjct: 845 CGDCHTFMKYVSIITKREILVRDASGFHCFRNGQCCCKDYW 885 >gb|PPR92500.1| hypothetical protein GOBAR_AA28167 [Gossypium barbadense] Length = 896 Score = 83.6 bits (205), Expect = 7e-16 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = +1 Query: 1 CGDCHTFLKYVSVVTKREIHVRDASGFHIFANGECSCKDYW 123 CGDCHTF+KYVS++TKREI VRDASGFH F NG+C CKDYW Sbjct: 856 CGDCHTFMKYVSIITKREILVRDASGFHCFRNGQCCCKDYW 896