BLASTX nr result
ID: Rehmannia30_contig00026103
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00026103 (629 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011080766.1| RNA-directed DNA methylation 4 [Sesamum indi... 84 3e-15 emb|CBI15854.3| unnamed protein product, partial [Vitis vinifera] 71 8e-11 ref|XP_010650841.1| PREDICTED: RNA-directed DNA methylation 4 is... 71 9e-11 ref|XP_010650840.1| PREDICTED: RNA-directed DNA methylation 4 is... 71 9e-11 ref|XP_022863404.1| RNA-directed DNA methylation 4 [Olea europae... 70 2e-10 emb|CDP04072.1| unnamed protein product [Coffea canephora] 69 3e-10 ref|XP_009621893.1| PREDICTED: RNA-directed DNA methylation 4 is... 67 9e-10 ref|XP_009621892.1| PREDICTED: RNA-directed DNA methylation 4 is... 67 9e-10 ref|XP_009621891.1| PREDICTED: RNA-directed DNA methylation 4 is... 67 1e-09 ref|XP_009621890.1| PREDICTED: RNA-directed DNA methylation 4 is... 67 1e-09 ref|XP_009621889.1| PREDICTED: RNA-directed DNA methylation 4 is... 67 1e-09 ref|XP_009768483.1| PREDICTED: RNA-directed DNA methylation 4 is... 66 3e-09 ref|XP_019247157.1| PREDICTED: RNA-directed DNA methylation 4 is... 66 3e-09 ref|XP_009768482.1| PREDICTED: RNA-directed DNA methylation 4 is... 66 3e-09 ref|XP_009768481.1| PREDICTED: RNA-directed DNA methylation 4 is... 66 4e-09 ref|XP_019247156.1| PREDICTED: RNA-directed DNA methylation 4 is... 66 4e-09 ref|XP_009768480.1| PREDICTED: RNA-directed DNA methylation 4 is... 66 4e-09 ref|XP_019247155.1| PREDICTED: RNA-directed DNA methylation 4 is... 66 4e-09 ref|XP_009768479.1| PREDICTED: RNA-directed DNA methylation 4 is... 66 4e-09 gb|OVA17240.1| hypothetical protein BVC80_1837g36 [Macleaya cord... 65 9e-09 >ref|XP_011080766.1| RNA-directed DNA methylation 4 [Sesamum indicum] Length = 371 Score = 83.6 bits (205), Expect = 3e-15 Identities = 39/43 (90%), Positives = 41/43 (95%) Frame = +2 Query: 500 KVLSRNARFEQIWRSRKEKKEAPEDEAIYEMCRLYDVVRVDVE 628 +V+SRNARFEQIWRSRK KKE PEDEAIYEMCRLYDVVRVDVE Sbjct: 128 EVISRNARFEQIWRSRKGKKETPEDEAIYEMCRLYDVVRVDVE 170 >emb|CBI15854.3| unnamed protein product, partial [Vitis vinifera] Length = 355 Score = 70.9 bits (172), Expect = 8e-11 Identities = 31/43 (72%), Positives = 39/43 (90%) Frame = +2 Query: 500 KVLSRNARFEQIWRSRKEKKEAPEDEAIYEMCRLYDVVRVDVE 628 ++L++NARFEQIWRSRK K EA +D+A++EMC LYDVVRVDVE Sbjct: 126 EILAKNARFEQIWRSRKGKNEAAQDKALHEMCHLYDVVRVDVE 168 >ref|XP_010650841.1| PREDICTED: RNA-directed DNA methylation 4 isoform X2 [Vitis vinifera] Length = 382 Score = 70.9 bits (172), Expect = 9e-11 Identities = 31/43 (72%), Positives = 39/43 (90%) Frame = +2 Query: 500 KVLSRNARFEQIWRSRKEKKEAPEDEAIYEMCRLYDVVRVDVE 628 ++L++NARFEQIWRSRK K EA +D+A++EMC LYDVVRVDVE Sbjct: 153 EILAKNARFEQIWRSRKGKNEAAQDKALHEMCHLYDVVRVDVE 195 >ref|XP_010650840.1| PREDICTED: RNA-directed DNA methylation 4 isoform X1 [Vitis vinifera] Length = 383 Score = 70.9 bits (172), Expect = 9e-11 Identities = 31/43 (72%), Positives = 39/43 (90%) Frame = +2 Query: 500 KVLSRNARFEQIWRSRKEKKEAPEDEAIYEMCRLYDVVRVDVE 628 ++L++NARFEQIWRSRK K EA +D+A++EMC LYDVVRVDVE Sbjct: 154 EILAKNARFEQIWRSRKGKNEAAQDKALHEMCHLYDVVRVDVE 196 >ref|XP_022863404.1| RNA-directed DNA methylation 4 [Olea europaea var. sylvestris] ref|XP_022863405.1| RNA-directed DNA methylation 4 [Olea europaea var. sylvestris] ref|XP_022863406.1| RNA-directed DNA methylation 4 [Olea europaea var. sylvestris] Length = 370 Score = 70.1 bits (170), Expect = 2e-10 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = +2 Query: 500 KVLSRNARFEQIWRSRKEKKEAPEDEAIYEMCRLYDVVRVDVE 628 +VLS+NARFEQIWRSRK K EA ED+A++EM RLYDVVRVD E Sbjct: 140 EVLSKNARFEQIWRSRKGKNEAVEDDAVHEMYRLYDVVRVDAE 182 >emb|CDP04072.1| unnamed protein product [Coffea canephora] Length = 360 Score = 69.3 bits (168), Expect = 3e-10 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = +2 Query: 500 KVLSRNARFEQIWRSRKEKKEAPEDEAIYEMCRLYDVVRVDVE 628 ++ S+NARFEQIWRSRK+K E D+A+ EMCRLYDVVRVDVE Sbjct: 129 EISSKNARFEQIWRSRKQKNEYANDDALQEMCRLYDVVRVDVE 171 >ref|XP_009621893.1| PREDICTED: RNA-directed DNA methylation 4 isoform X5 [Nicotiana tomentosiformis] Length = 298 Score = 67.4 bits (163), Expect = 9e-10 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = +2 Query: 506 LSRNARFEQIWRSRKEKKEAPEDEAIYEMCRLYDVVRVDVE 628 LS+NARFEQIW+SRKEKK+ DE + EMCRLYDV+RVD E Sbjct: 132 LSKNARFEQIWKSRKEKKKLMHDEELNEMCRLYDVIRVDTE 172 >ref|XP_009621892.1| PREDICTED: RNA-directed DNA methylation 4 isoform X4 [Nicotiana tomentosiformis] Length = 301 Score = 67.4 bits (163), Expect = 9e-10 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = +2 Query: 506 LSRNARFEQIWRSRKEKKEAPEDEAIYEMCRLYDVVRVDVE 628 LS+NARFEQIW+SRKEKK+ DE + EMCRLYDV+RVD E Sbjct: 132 LSKNARFEQIWKSRKEKKKLMHDEELNEMCRLYDVIRVDTE 172 >ref|XP_009621891.1| PREDICTED: RNA-directed DNA methylation 4 isoform X3 [Nicotiana tomentosiformis] ref|XP_016512236.1| PREDICTED: RNA-directed DNA methylation 4-like isoform X3 [Nicotiana tabacum] Length = 354 Score = 67.4 bits (163), Expect = 1e-09 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = +2 Query: 506 LSRNARFEQIWRSRKEKKEAPEDEAIYEMCRLYDVVRVDVE 628 LS+NARFEQIW+SRKEKK+ DE + EMCRLYDV+RVD E Sbjct: 132 LSKNARFEQIWKSRKEKKKLMHDEELNEMCRLYDVIRVDTE 172 >ref|XP_009621890.1| PREDICTED: RNA-directed DNA methylation 4 isoform X2 [Nicotiana tomentosiformis] ref|XP_016512235.1| PREDICTED: RNA-directed DNA methylation 4-like isoform X2 [Nicotiana tabacum] Length = 356 Score = 67.4 bits (163), Expect = 1e-09 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = +2 Query: 506 LSRNARFEQIWRSRKEKKEAPEDEAIYEMCRLYDVVRVDVE 628 LS+NARFEQIW+SRKEKK+ DE + EMCRLYDV+RVD E Sbjct: 131 LSKNARFEQIWKSRKEKKKLMHDEELNEMCRLYDVIRVDTE 171 >ref|XP_009621889.1| PREDICTED: RNA-directed DNA methylation 4 isoform X1 [Nicotiana tomentosiformis] ref|XP_016512234.1| PREDICTED: RNA-directed DNA methylation 4-like isoform X1 [Nicotiana tabacum] Length = 357 Score = 67.4 bits (163), Expect = 1e-09 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = +2 Query: 506 LSRNARFEQIWRSRKEKKEAPEDEAIYEMCRLYDVVRVDVE 628 LS+NARFEQIW+SRKEKK+ DE + EMCRLYDV+RVD E Sbjct: 132 LSKNARFEQIWKSRKEKKKLMHDEELNEMCRLYDVIRVDTE 172 >ref|XP_009768483.1| PREDICTED: RNA-directed DNA methylation 4 isoform X5 [Nicotiana sylvestris] Length = 300 Score = 65.9 bits (159), Expect = 3e-09 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = +2 Query: 506 LSRNARFEQIWRSRKEKKEAPEDEAIYEMCRLYDVVRVDVE 628 LS+NARFEQIW+SRKEK++ DE + EMCRLYDV+RVD E Sbjct: 132 LSKNARFEQIWKSRKEKEKLMHDEELNEMCRLYDVIRVDTE 172 >ref|XP_019247157.1| PREDICTED: RNA-directed DNA methylation 4 isoform X3 [Nicotiana attenuata] Length = 303 Score = 65.9 bits (159), Expect = 3e-09 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = +2 Query: 506 LSRNARFEQIWRSRKEKKEAPEDEAIYEMCRLYDVVRVDVE 628 LS+NARFEQIW+SRKEK++ DE + EMCRLYDV+RVD E Sbjct: 132 LSKNARFEQIWKSRKEKEKLMHDEELNEMCRLYDVIRVDTE 172 >ref|XP_009768482.1| PREDICTED: RNA-directed DNA methylation 4 isoform X4 [Nicotiana sylvestris] Length = 303 Score = 65.9 bits (159), Expect = 3e-09 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = +2 Query: 506 LSRNARFEQIWRSRKEKKEAPEDEAIYEMCRLYDVVRVDVE 628 LS+NARFEQIW+SRKEK++ DE + EMCRLYDV+RVD E Sbjct: 132 LSKNARFEQIWKSRKEKEKLMHDEELNEMCRLYDVIRVDTE 172 >ref|XP_009768481.1| PREDICTED: RNA-directed DNA methylation 4 isoform X3 [Nicotiana sylvestris] Length = 356 Score = 65.9 bits (159), Expect = 4e-09 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = +2 Query: 506 LSRNARFEQIWRSRKEKKEAPEDEAIYEMCRLYDVVRVDVE 628 LS+NARFEQIW+SRKEK++ DE + EMCRLYDV+RVD E Sbjct: 132 LSKNARFEQIWKSRKEKEKLMHDEELNEMCRLYDVIRVDTE 172 >ref|XP_019247156.1| PREDICTED: RNA-directed DNA methylation 4 isoform X2 [Nicotiana attenuata] Length = 358 Score = 65.9 bits (159), Expect = 4e-09 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = +2 Query: 506 LSRNARFEQIWRSRKEKKEAPEDEAIYEMCRLYDVVRVDVE 628 LS+NARFEQIW+SRKEK++ DE + EMCRLYDV+RVD E Sbjct: 131 LSKNARFEQIWKSRKEKEKLMHDEELNEMCRLYDVIRVDTE 171 >ref|XP_009768480.1| PREDICTED: RNA-directed DNA methylation 4 isoform X2 [Nicotiana sylvestris] ref|XP_016485801.1| PREDICTED: RNA-directed DNA methylation 4-like isoform X2 [Nicotiana tabacum] Length = 358 Score = 65.9 bits (159), Expect = 4e-09 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = +2 Query: 506 LSRNARFEQIWRSRKEKKEAPEDEAIYEMCRLYDVVRVDVE 628 LS+NARFEQIW+SRKEK++ DE + EMCRLYDV+RVD E Sbjct: 131 LSKNARFEQIWKSRKEKEKLMHDEELNEMCRLYDVIRVDTE 171 >ref|XP_019247155.1| PREDICTED: RNA-directed DNA methylation 4 isoform X1 [Nicotiana attenuata] gb|OIT01933.1| rna-directed dna methylation 4 [Nicotiana attenuata] Length = 359 Score = 65.9 bits (159), Expect = 4e-09 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = +2 Query: 506 LSRNARFEQIWRSRKEKKEAPEDEAIYEMCRLYDVVRVDVE 628 LS+NARFEQIW+SRKEK++ DE + EMCRLYDV+RVD E Sbjct: 132 LSKNARFEQIWKSRKEKEKLMHDEELNEMCRLYDVIRVDTE 172 >ref|XP_009768479.1| PREDICTED: RNA-directed DNA methylation 4 isoform X1 [Nicotiana sylvestris] ref|XP_016485800.1| PREDICTED: RNA-directed DNA methylation 4-like isoform X1 [Nicotiana tabacum] Length = 359 Score = 65.9 bits (159), Expect = 4e-09 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = +2 Query: 506 LSRNARFEQIWRSRKEKKEAPEDEAIYEMCRLYDVVRVDVE 628 LS+NARFEQIW+SRKEK++ DE + EMCRLYDV+RVD E Sbjct: 132 LSKNARFEQIWKSRKEKEKLMHDEELNEMCRLYDVIRVDTE 172 >gb|OVA17240.1| hypothetical protein BVC80_1837g36 [Macleaya cordata] Length = 307 Score = 64.7 bits (156), Expect = 9e-09 Identities = 31/55 (56%), Positives = 41/55 (74%), Gaps = 6/55 (10%) Frame = +2 Query: 482 YNYIPFK------VLSRNARFEQIWRSRKEKKEAPEDEAIYEMCRLYDVVRVDVE 628 ++ IPF VL+++ARFEQIW+ RK KKE D++I+E+C LYDVVRVDVE Sbjct: 94 FSIIPFPWHCDPYVLAKHARFEQIWKRRKGKKETMHDDSIHELCHLYDVVRVDVE 148