BLASTX nr result
ID: Rehmannia30_contig00025484
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00025484 (489 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN04680.1| 1, 2-alpha-mannosidase [Handroanthus impetiginosus] 69 2e-10 ref|XP_011096552.1| mannosyl-oligosaccharide 1,2-alpha-mannosida... 64 1e-08 ref|XP_019198194.1| PREDICTED: mannosyl-oligosaccharide 1,2-alph... 60 1e-07 ref|XP_012842222.1| PREDICTED: mannosyl-oligosaccharide 1,2-alph... 59 3e-07 ref|XP_009360883.1| PREDICTED: mannosyl-oligosaccharide 1,2-alph... 59 5e-07 ref|XP_017190700.1| PREDICTED: mannosyl-oligosaccharide 1,2-alph... 59 5e-07 dbj|GAV66442.1| Glyco_hydro_47 domain-containing protein [Cephal... 59 6e-07 gb|PNT41007.1| hypothetical protein POPTR_004G132300v3 [Populus ... 59 6e-07 ref|XP_011014924.1| PREDICTED: mannosyl-oligosaccharide 1,2-alph... 59 6e-07 ref|XP_002306001.2| glycoside hydrolase family 47 family protein... 59 6e-07 gb|KZV21392.1| hypothetical protein F511_18558 [Dorcoceras hygro... 59 6e-07 ref|XP_021599274.1| mannosyl-oligosaccharide 1,2-alpha-mannosida... 58 1e-06 gb|ONI10983.1| hypothetical protein PRUPE_4G080100 [Prunus persica] 58 1e-06 ref|XP_021594492.1| mannosyl-oligosaccharide 1,2-alpha-mannosida... 58 1e-06 ref|XP_021599273.1| mannosyl-oligosaccharide 1,2-alpha-mannosida... 58 1e-06 ref|XP_008225477.1| PREDICTED: mannosyl-oligosaccharide 1,2-alph... 58 1e-06 ref|XP_007214534.1| mannosyl-oligosaccharide 1,2-alpha-mannosida... 58 1e-06 gb|KIL00823.1| glycoside hydrolase family 47 protein [Paxillus r... 57 2e-06 ref|XP_024156520.1| mannosyl-oligosaccharide 1,2-alpha-mannosida... 57 2e-06 ref|XP_021834192.1| mannosyl-oligosaccharide 1,2-alpha-mannosida... 57 2e-06 >gb|PIN04680.1| 1, 2-alpha-mannosidase [Handroanthus impetiginosus] Length = 630 Score = 68.6 bits (166), Expect = 2e-10 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -3 Query: 487 YLYLLFGDRDVLPLNEYVFNTEAHPLPIRGTAGRK 383 YLYLLFGDRDV+PL+EYVFNTEAHP PIRG AG K Sbjct: 596 YLYLLFGDRDVIPLDEYVFNTEAHPFPIRGNAGTK 630 >ref|XP_011096552.1| mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3 [Sesamum indicum] Length = 631 Score = 63.5 bits (153), Expect = 1e-08 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -3 Query: 487 YLYLLFGDRDVLPLNEYVFNTEAHPLPIRGTAGRK 383 YLYLLFGDR+ +PL++YVFNTEAHPLPI+G AG K Sbjct: 597 YLYLLFGDRNAIPLDKYVFNTEAHPLPIQGNAGTK 631 >ref|XP_019198194.1| PREDICTED: mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3 [Ipomoea nil] Length = 632 Score = 60.5 bits (145), Expect = 1e-07 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -3 Query: 487 YLYLLFGDRDVLPLNEYVFNTEAHPLPIRGTA 392 YLYLLFG DV+PL++YVFNTEAHP+PI+GTA Sbjct: 598 YLYLLFGSSDVIPLDQYVFNTEAHPIPIKGTA 629 >ref|XP_012842222.1| PREDICTED: mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3 [Erythranthe guttata] gb|EYU33358.1| hypothetical protein MIMGU_mgv1a002872mg [Erythranthe guttata] Length = 629 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -3 Query: 487 YLYLLFGDRDVLPLNEYVFNTEAHPLPIRGTAGR 386 YLYLLFGDR+V+PL++YVFNTEAHP PIR A R Sbjct: 595 YLYLLFGDRNVIPLDKYVFNTEAHPFPIRDNAVR 628 >ref|XP_009360883.1| PREDICTED: mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3 [Pyrus x bretschneideri] Length = 630 Score = 58.9 bits (141), Expect = 5e-07 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -3 Query: 487 YLYLLFGDRDVLPLNEYVFNTEAHPLPIRGTAGR 386 YLYLLFGD V+PL+++VFNTEAHP+PI GTA R Sbjct: 596 YLYLLFGDSSVIPLDKFVFNTEAHPIPIEGTAKR 629 >ref|XP_017190700.1| PREDICTED: mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3-like [Malus domestica] Length = 630 Score = 58.9 bits (141), Expect = 5e-07 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -3 Query: 487 YLYLLFGDRDVLPLNEYVFNTEAHPLPIRGTAGR 386 YLYLLFGD V+PL+++VFNTEAHP+PI GTA R Sbjct: 596 YLYLLFGDSSVIPLDKFVFNTEAHPIPIEGTAKR 629 >dbj|GAV66442.1| Glyco_hydro_47 domain-containing protein [Cephalotus follicularis] Length = 627 Score = 58.5 bits (140), Expect = 6e-07 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = -3 Query: 487 YLYLLFGDRDVLPLNEYVFNTEAHPLPIRGTAGRK 383 Y YLLFGD +V+PL++YVFNTEAHPLPI+GT R+ Sbjct: 592 YFYLLFGDSNVIPLDKYVFNTEAHPLPIKGTILRE 626 >gb|PNT41007.1| hypothetical protein POPTR_004G132300v3 [Populus trichocarpa] Length = 631 Score = 58.5 bits (140), Expect = 6e-07 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -3 Query: 487 YLYLLFGDRDVLPLNEYVFNTEAHPLPIRGT 395 Y YLLFGDR V+PL++YVFNTEAHPLPI+G+ Sbjct: 601 YFYLLFGDRSVIPLDKYVFNTEAHPLPIKGS 631 >ref|XP_011014924.1| PREDICTED: mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3 [Populus euphratica] Length = 631 Score = 58.5 bits (140), Expect = 6e-07 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -3 Query: 487 YLYLLFGDRDVLPLNEYVFNTEAHPLPIRGT 395 Y YLLFGDR V+PL++YVFNTEAHPLPI+G+ Sbjct: 601 YFYLLFGDRSVIPLDKYVFNTEAHPLPIKGS 631 >ref|XP_002306001.2| glycoside hydrolase family 47 family protein [Populus trichocarpa] Length = 631 Score = 58.5 bits (140), Expect = 6e-07 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -3 Query: 487 YLYLLFGDRDVLPLNEYVFNTEAHPLPIRGT 395 Y YLLFGDR V+PL++YVFNTEAHPLPI+G+ Sbjct: 601 YFYLLFGDRSVIPLDKYVFNTEAHPLPIKGS 631 >gb|KZV21392.1| hypothetical protein F511_18558 [Dorcoceras hygrometricum] Length = 632 Score = 58.5 bits (140), Expect = 6e-07 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -3 Query: 487 YLYLLFGDRDVLPLNEYVFNTEAHPLPIRGTAGRK 383 YLYLLFGD + +PL+EYVFNTEAHP+PI+ TA K Sbjct: 598 YLYLLFGDSNAIPLDEYVFNTEAHPIPIQRTASMK 632 >ref|XP_021599274.1| mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3 isoform X2 [Manihot esculenta] Length = 579 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -3 Query: 487 YLYLLFGDRDVLPLNEYVFNTEAHPLPIRGT 395 YLYLLFGD V+PL+++VFNTEAHPLPI+GT Sbjct: 549 YLYLLFGDTSVIPLDKFVFNTEAHPLPIKGT 579 >gb|ONI10983.1| hypothetical protein PRUPE_4G080100 [Prunus persica] Length = 606 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -3 Query: 487 YLYLLFGDRDVLPLNEYVFNTEAHPLPIRGTAGR 386 YLYLLFGD VLPL+++VFNTEAHP+P+ GT R Sbjct: 572 YLYLLFGDSSVLPLDKFVFNTEAHPIPVEGTTKR 605 >ref|XP_021594492.1| mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3-like [Manihot esculenta] gb|OAY29138.1| hypothetical protein MANES_15G120800 [Manihot esculenta] Length = 629 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -3 Query: 487 YLYLLFGDRDVLPLNEYVFNTEAHPLPIRGT 395 YLYLLFGD V+PL+++VFNTEAHPLPI+GT Sbjct: 599 YLYLLFGDSSVIPLDKFVFNTEAHPLPIKGT 629 >ref|XP_021599273.1| mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3 isoform X1 [Manihot esculenta] gb|OAY25126.1| hypothetical protein MANES_17G069200 [Manihot esculenta] Length = 629 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -3 Query: 487 YLYLLFGDRDVLPLNEYVFNTEAHPLPIRGT 395 YLYLLFGD V+PL+++VFNTEAHPLPI+GT Sbjct: 599 YLYLLFGDTSVIPLDKFVFNTEAHPLPIKGT 629 >ref|XP_008225477.1| PREDICTED: mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3 [Prunus mume] Length = 633 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -3 Query: 487 YLYLLFGDRDVLPLNEYVFNTEAHPLPIRGTAGR 386 YLYLLFGD VLPL+++VFNTEAHP+P+ GT R Sbjct: 599 YLYLLFGDSSVLPLDKFVFNTEAHPIPVEGTTKR 632 >ref|XP_007214534.1| mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3 [Prunus persica] gb|ONI10982.1| hypothetical protein PRUPE_4G080100 [Prunus persica] Length = 633 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -3 Query: 487 YLYLLFGDRDVLPLNEYVFNTEAHPLPIRGTAGR 386 YLYLLFGD VLPL+++VFNTEAHP+P+ GT R Sbjct: 599 YLYLLFGDSSVLPLDKFVFNTEAHPIPVEGTTKR 632 >gb|KIL00823.1| glycoside hydrolase family 47 protein [Paxillus rubicundulus Ve08.2h10] Length = 586 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -3 Query: 487 YLYLLFGDRDVLPLNEYVFNTEAHPLPIRG 398 YLYLLF D VLPLNEYVFNTEAHPLPI G Sbjct: 549 YLYLLFSDASVLPLNEYVFNTEAHPLPIFG 578 >ref|XP_024156520.1| mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3 [Rosa chinensis] gb|PRQ29449.1| putative mannosyl-oligosaccharide 1,2-alpha-mannosidase [Rosa chinensis] Length = 626 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -3 Query: 487 YLYLLFGDRDVLPLNEYVFNTEAHPLPIRGTAGR 386 YLYLLFGD ++PL++YVFNTEAHP+PI GT R Sbjct: 592 YLYLLFGDTSLVPLDKYVFNTEAHPIPIEGTTKR 625 >ref|XP_021834192.1| mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3 [Prunus avium] Length = 633 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -3 Query: 487 YLYLLFGDRDVLPLNEYVFNTEAHPLPIRGTAGR 386 YLYLLFGD VLPL+++VFNTEAHP+P+ GT R Sbjct: 599 YLYLLFGDSGVLPLDKFVFNTEAHPIPVEGTTKR 632