BLASTX nr result
ID: Rehmannia30_contig00025269
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00025269 (420 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011072672.1| CCAAT/enhancer-binding protein zeta [Sesamum... 97 1e-20 ref|XP_018839909.1| PREDICTED: uncharacterized protein C4F10.09c... 89 3e-20 ref|XP_023892840.1| uncharacterized protein C4F10.09c [Quercus s... 95 6e-20 ref|XP_008462258.1| PREDICTED: CCAAT/enhancer-binding protein ze... 95 8e-20 ref|XP_004141820.1| PREDICTED: CCAAT/enhancer-binding protein ze... 95 8e-20 ref|XP_022842608.1| uncharacterized protein C4F10.09c [Olea euro... 94 1e-19 ref|XP_022148696.1| CCAAT/enhancer-binding protein zeta [Momordi... 94 2e-19 ref|XP_023514706.1| CCAAT/enhancer-binding protein zeta [Cucurbi... 94 2e-19 ref|XP_022964285.1| CCAAT/enhancer-binding protein zeta [Cucurbi... 94 2e-19 ref|XP_022999988.1| CCAAT/enhancer-binding protein zeta [Cucurbi... 94 2e-19 gb|EPS70469.1| hypothetical protein M569_04290, partial [Genlise... 93 3e-19 ref|XP_019193867.1| PREDICTED: CCAAT/enhancer-binding protein ze... 93 4e-19 ref|XP_018839903.1| PREDICTED: uncharacterized protein C4F10.09c... 91 1e-18 ref|XP_015902260.1| PREDICTED: CCAAT/enhancer-binding protein ze... 91 2e-18 ref|XP_003611899.2| CCAAT-binding factor [Medicago truncatula] >... 91 2e-18 ref|XP_003609661.2| CCAAT-binding factor [Medicago truncatula] >... 91 2e-18 gb|OVA01161.1| CCAAT-binding factor [Macleaya cordata] 90 3e-18 ref|XP_016562441.1| PREDICTED: uncharacterized protein C4F10.09c... 90 3e-18 ref|XP_004235535.1| PREDICTED: uncharacterized protein C4F10.09c... 90 3e-18 ref|XP_015067294.1| PREDICTED: uncharacterized protein C4F10.09c... 90 3e-18 >ref|XP_011072672.1| CCAAT/enhancer-binding protein zeta [Sesamum indicum] Length = 1017 Score = 97.1 bits (240), Expect = 1e-20 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = +2 Query: 110 TIYILLKSKSEQERRLLSALVNKLGDPENKVASNADYHLANLLAEHPNMK 259 TIY+LLKSKSEQERRLLS+LVNKLGDPENKVASNADYHLANLL EHPNMK Sbjct: 310 TIYMLLKSKSEQERRLLSSLVNKLGDPENKVASNADYHLANLLTEHPNMK 359 >ref|XP_018839909.1| PREDICTED: uncharacterized protein C4F10.09c-like [Juglans regia] Length = 96 Score = 88.6 bits (218), Expect = 3e-20 Identities = 42/49 (85%), Positives = 47/49 (95%) Frame = +2 Query: 113 IYILLKSKSEQERRLLSALVNKLGDPENKVASNADYHLANLLAEHPNMK 259 +Y LLKSKSEQERRLLSALVNKLGDPENK ASNAD+H+ANLL++HPNMK Sbjct: 1 MYALLKSKSEQERRLLSALVNKLGDPENKGASNADFHMANLLSDHPNMK 49 >ref|XP_023892840.1| uncharacterized protein C4F10.09c [Quercus suber] gb|POE60368.1| ccaat/enhancer-binding protein zeta [Quercus suber] Length = 1061 Score = 95.1 bits (235), Expect = 6e-20 Identities = 45/50 (90%), Positives = 49/50 (98%) Frame = +2 Query: 110 TIYILLKSKSEQERRLLSALVNKLGDPENKVASNADYHLANLLAEHPNMK 259 TIY+LLKSKSEQERRLLSALVNKLGDPENK ASNAD+HLANLL++HPNMK Sbjct: 353 TIYVLLKSKSEQERRLLSALVNKLGDPENKAASNADFHLANLLSDHPNMK 402 >ref|XP_008462258.1| PREDICTED: CCAAT/enhancer-binding protein zeta [Cucumis melo] Length = 1025 Score = 94.7 bits (234), Expect = 8e-20 Identities = 45/50 (90%), Positives = 49/50 (98%) Frame = +2 Query: 110 TIYILLKSKSEQERRLLSALVNKLGDPENKVASNADYHLANLLAEHPNMK 259 TIY+LLKSKSEQERRLLSALVNKLGDPENK AS+ADYHL+NLL+EHPNMK Sbjct: 315 TIYVLLKSKSEQERRLLSALVNKLGDPENKTASSADYHLSNLLSEHPNMK 364 >ref|XP_004141820.1| PREDICTED: CCAAT/enhancer-binding protein zeta [Cucumis sativus] gb|KGN45456.1| hypothetical protein Csa_7G448670 [Cucumis sativus] Length = 1030 Score = 94.7 bits (234), Expect = 8e-20 Identities = 45/50 (90%), Positives = 49/50 (98%) Frame = +2 Query: 110 TIYILLKSKSEQERRLLSALVNKLGDPENKVASNADYHLANLLAEHPNMK 259 TIY+LLKSKSEQERRLLSALVNKLGDPENK AS+ADYHL+NLL+EHPNMK Sbjct: 317 TIYVLLKSKSEQERRLLSALVNKLGDPENKTASSADYHLSNLLSEHPNMK 366 >ref|XP_022842608.1| uncharacterized protein C4F10.09c [Olea europaea var. sylvestris] Length = 996 Score = 94.4 bits (233), Expect = 1e-19 Identities = 47/60 (78%), Positives = 52/60 (86%) Frame = +2 Query: 80 LDLMFYPMSHTIYILLKSKSEQERRLLSALVNKLGDPENKVASNADYHLANLLAEHPNMK 259 LD++ T+Y LL+SKSEQERRLLSALVNKLG PENKVASNADYHLANLLA+HPNMK Sbjct: 305 LDILRNKALKTMYTLLRSKSEQERRLLSALVNKLGHPENKVASNADYHLANLLADHPNMK 364 >ref|XP_022148696.1| CCAAT/enhancer-binding protein zeta [Momordica charantia] Length = 1012 Score = 93.6 bits (231), Expect = 2e-19 Identities = 44/50 (88%), Positives = 49/50 (98%) Frame = +2 Query: 110 TIYILLKSKSEQERRLLSALVNKLGDPENKVASNADYHLANLLAEHPNMK 259 TIY+LLKSKSEQERRLLSALVNKLGDPENK AS+ADYHL+NLL++HPNMK Sbjct: 312 TIYVLLKSKSEQERRLLSALVNKLGDPENKTASSADYHLSNLLSDHPNMK 361 >ref|XP_023514706.1| CCAAT/enhancer-binding protein zeta [Cucurbita pepo subsp. pepo] Length = 1016 Score = 93.6 bits (231), Expect = 2e-19 Identities = 44/50 (88%), Positives = 49/50 (98%) Frame = +2 Query: 110 TIYILLKSKSEQERRLLSALVNKLGDPENKVASNADYHLANLLAEHPNMK 259 TIY+LLKSKSEQERRLLSALVNKLGDPENK AS+ADYHL+NLL++HPNMK Sbjct: 314 TIYVLLKSKSEQERRLLSALVNKLGDPENKTASSADYHLSNLLSDHPNMK 363 >ref|XP_022964285.1| CCAAT/enhancer-binding protein zeta [Cucurbita moschata] Length = 1018 Score = 93.6 bits (231), Expect = 2e-19 Identities = 44/50 (88%), Positives = 49/50 (98%) Frame = +2 Query: 110 TIYILLKSKSEQERRLLSALVNKLGDPENKVASNADYHLANLLAEHPNMK 259 TIY+LLKSKSEQERRLLSALVNKLGDPENK AS+ADYHL+NLL++HPNMK Sbjct: 314 TIYVLLKSKSEQERRLLSALVNKLGDPENKTASSADYHLSNLLSDHPNMK 363 >ref|XP_022999988.1| CCAAT/enhancer-binding protein zeta [Cucurbita maxima] Length = 1020 Score = 93.6 bits (231), Expect = 2e-19 Identities = 44/50 (88%), Positives = 49/50 (98%) Frame = +2 Query: 110 TIYILLKSKSEQERRLLSALVNKLGDPENKVASNADYHLANLLAEHPNMK 259 TIY+LLKSKSEQERRLLSALVNKLGDPENK AS+ADYHL+NLL++HPNMK Sbjct: 314 TIYVLLKSKSEQERRLLSALVNKLGDPENKTASSADYHLSNLLSDHPNMK 363 >gb|EPS70469.1| hypothetical protein M569_04290, partial [Genlisea aurea] Length = 524 Score = 92.8 bits (229), Expect = 3e-19 Identities = 44/50 (88%), Positives = 47/50 (94%) Frame = +2 Query: 110 TIYILLKSKSEQERRLLSALVNKLGDPENKVASNADYHLANLLAEHPNMK 259 T Y+LLK+KSEQERRLLS LVNKLGDPENKVASNADYHL NLL+EHPNMK Sbjct: 296 TTYVLLKNKSEQERRLLSLLVNKLGDPENKVASNADYHLTNLLSEHPNMK 345 >ref|XP_019193867.1| PREDICTED: CCAAT/enhancer-binding protein zeta [Ipomoea nil] Length = 995 Score = 92.8 bits (229), Expect = 4e-19 Identities = 45/60 (75%), Positives = 52/60 (86%) Frame = +2 Query: 80 LDLMFYPMSHTIYILLKSKSEQERRLLSALVNKLGDPENKVASNADYHLANLLAEHPNMK 259 LD++ T+Y+LL+SKSEQERRLLSALVNKLGDP+NKVASNADYHL+ LL EHPNMK Sbjct: 301 LDILKDKALKTVYMLLRSKSEQERRLLSALVNKLGDPKNKVASNADYHLSKLLGEHPNMK 360 >ref|XP_018839903.1| PREDICTED: uncharacterized protein C4F10.09c-like [Juglans regia] Length = 1058 Score = 91.3 bits (225), Expect = 1e-18 Identities = 44/50 (88%), Positives = 48/50 (96%) Frame = +2 Query: 110 TIYILLKSKSEQERRLLSALVNKLGDPENKVASNADYHLANLLAEHPNMK 259 T+Y LLKSKSEQERRLLSALVNKLGDPENK ASNAD+HLANLL++HPNMK Sbjct: 349 TMYALLKSKSEQERRLLSALVNKLGDPENKGASNADFHLANLLSDHPNMK 398 >ref|XP_015902260.1| PREDICTED: CCAAT/enhancer-binding protein zeta [Ziziphus jujuba] Length = 1023 Score = 90.9 bits (224), Expect = 2e-18 Identities = 45/60 (75%), Positives = 52/60 (86%) Frame = +2 Query: 80 LDLMFYPMSHTIYILLKSKSEQERRLLSALVNKLGDPENKVASNADYHLANLLAEHPNMK 259 L ++ + TIY LLKSKSEQERRLLSALVNKLGDPE+K ASNAD+HL+NLL+EHPNMK Sbjct: 305 LPILKHKALKTIYSLLKSKSEQERRLLSALVNKLGDPESKSASNADFHLSNLLSEHPNMK 364 >ref|XP_003611899.2| CCAAT-binding factor [Medicago truncatula] gb|AES94857.2| CCAAT-binding factor [Medicago truncatula] Length = 1026 Score = 90.5 bits (223), Expect = 2e-18 Identities = 42/50 (84%), Positives = 47/50 (94%) Frame = +2 Query: 110 TIYILLKSKSEQERRLLSALVNKLGDPENKVASNADYHLANLLAEHPNMK 259 TIY+LL KSEQERRLLSALVNKLGDP+NK ASNADYHL+NLL++HPNMK Sbjct: 325 TIYVLLSRKSEQERRLLSALVNKLGDPDNKAASNADYHLSNLLSQHPNMK 374 >ref|XP_003609661.2| CCAAT-binding factor [Medicago truncatula] gb|AES91858.2| CCAAT-binding factor [Medicago truncatula] Length = 1032 Score = 90.5 bits (223), Expect = 2e-18 Identities = 42/50 (84%), Positives = 47/50 (94%) Frame = +2 Query: 110 TIYILLKSKSEQERRLLSALVNKLGDPENKVASNADYHLANLLAEHPNMK 259 TIY+LL KSEQERRLLSALVNKLGDP+NK ASNADYHL+NLL++HPNMK Sbjct: 324 TIYVLLSRKSEQERRLLSALVNKLGDPDNKAASNADYHLSNLLSQHPNMK 373 >gb|OVA01161.1| CCAAT-binding factor [Macleaya cordata] Length = 991 Score = 90.1 bits (222), Expect = 3e-18 Identities = 43/50 (86%), Positives = 48/50 (96%) Frame = +2 Query: 110 TIYILLKSKSEQERRLLSALVNKLGDPENKVASNADYHLANLLAEHPNMK 259 T+Y LL+SKSEQERRLLSALVNKLGDPENK ASNAD+HL+NLL+EHPNMK Sbjct: 358 TMYALLRSKSEQERRLLSALVNKLGDPENKGASNADFHLSNLLSEHPNMK 407 >ref|XP_016562441.1| PREDICTED: uncharacterized protein C4F10.09c [Capsicum annuum] Length = 1033 Score = 90.1 bits (222), Expect = 3e-18 Identities = 43/60 (71%), Positives = 51/60 (85%) Frame = +2 Query: 80 LDLMFYPMSHTIYILLKSKSEQERRLLSALVNKLGDPENKVASNADYHLANLLAEHPNMK 259 LD++ T+Y+LLK K EQERRLL+ALVNKLGDP+NKVASNADYHL+ LLA+HPNMK Sbjct: 296 LDILKDKALKTVYVLLKCKPEQERRLLAALVNKLGDPKNKVASNADYHLSKLLADHPNMK 355 >ref|XP_004235535.1| PREDICTED: uncharacterized protein C4F10.09c [Solanum lycopersicum] Length = 1052 Score = 90.1 bits (222), Expect = 3e-18 Identities = 43/60 (71%), Positives = 51/60 (85%) Frame = +2 Query: 80 LDLMFYPMSHTIYILLKSKSEQERRLLSALVNKLGDPENKVASNADYHLANLLAEHPNMK 259 LD++ T+Y+LLK K EQERRLL+ALVNKLGDP+NKVASNADYHL+ LLA+HPNMK Sbjct: 304 LDILKDKALKTVYVLLKCKPEQERRLLAALVNKLGDPKNKVASNADYHLSKLLADHPNMK 363 >ref|XP_015067294.1| PREDICTED: uncharacterized protein C4F10.09c [Solanum pennellii] Length = 1055 Score = 90.1 bits (222), Expect = 3e-18 Identities = 43/60 (71%), Positives = 51/60 (85%) Frame = +2 Query: 80 LDLMFYPMSHTIYILLKSKSEQERRLLSALVNKLGDPENKVASNADYHLANLLAEHPNMK 259 LD++ T+Y+LLK K EQERRLL+ALVNKLGDP+NKVASNADYHL+ LLA+HPNMK Sbjct: 307 LDILKDKALKTVYVLLKCKPEQERRLLAALVNKLGDPKNKVASNADYHLSKLLADHPNMK 366