BLASTX nr result
ID: Rehmannia30_contig00025122
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00025122 (449 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011081306.2| ethylene-responsive transcription factor ERF... 69 3e-11 >ref|XP_011081306.2| ethylene-responsive transcription factor ERF039-like [Sesamum indicum] Length = 250 Score = 69.3 bits (168), Expect = 3e-11 Identities = 35/57 (61%), Positives = 38/57 (66%), Gaps = 2/57 (3%) Frame = +1 Query: 43 DDAFLGLPDLFLGIGGRYRLDGWLCTAA--PPWVQVAAGGGEGVRGDLLEEGLFTWD 207 DDAFLGLPDLFLGI G Y+LDGW CTAA P +QVA GGE G+ E WD Sbjct: 194 DDAFLGLPDLFLGISGHYQLDGWFCTAAAGAPLLQVA--GGEAFHGEFSPEDFVPWD 248