BLASTX nr result
ID: Rehmannia30_contig00024269
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00024269 (421 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN16301.1| hypothetical protein CDL12_11047 [Handroanthus im... 63 7e-09 gb|PIN04264.1| hypothetical protein CDL12_23199 [Handroanthus im... 62 3e-08 >gb|PIN16301.1| hypothetical protein CDL12_11047 [Handroanthus impetiginosus] Length = 426 Score = 63.2 bits (152), Expect = 7e-09 Identities = 28/51 (54%), Positives = 41/51 (80%) Frame = +3 Query: 261 LVDDLPAFCRSNSPVRDIDPFYQKFSERMRFFDALYHERLYGMNAILDDHL 413 LV+ LPA C SNS D F+QK++E+MRFF+ L+HER+YG++AIL++H+ Sbjct: 118 LVEYLPALCSSNS-----DSFHQKYTEKMRFFEVLHHERVYGLDAILNEHI 163 >gb|PIN04264.1| hypothetical protein CDL12_23199 [Handroanthus impetiginosus] Length = 511 Score = 61.6 bits (148), Expect = 3e-08 Identities = 28/51 (54%), Positives = 40/51 (78%) Frame = +3 Query: 261 LVDDLPAFCRSNSPVRDIDPFYQKFSERMRFFDALYHERLYGMNAILDDHL 413 LV+ LPA C SNS D F+QK++E+MRFF+ L HER+YG++AIL++H+ Sbjct: 192 LVEYLPALCSSNS-----DSFHQKYTEKMRFFEVLNHERVYGLDAILNEHI 237