BLASTX nr result
ID: Rehmannia30_contig00024027
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00024027 (557 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN08985.1| hypothetical protein CDL12_18441 [Handroanthus im... 67 2e-10 >gb|PIN08985.1| hypothetical protein CDL12_18441 [Handroanthus impetiginosus] Length = 196 Score = 67.0 bits (162), Expect = 2e-10 Identities = 34/44 (77%), Positives = 40/44 (90%) Frame = +2 Query: 14 SNLDAINSRKTKPVIKMEDTAQKLSGLKALVFLQVALVIVIVAF 145 S+LD+++SRKTKP IKMED+A KLSGLKA+VFLQVALVI VAF Sbjct: 139 SDLDSVDSRKTKPGIKMEDSASKLSGLKAMVFLQVALVIGFVAF 182