BLASTX nr result
ID: Rehmannia30_contig00023967
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00023967 (433 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN09179.1| Oleoyl-[acyl-carrier-protein] hydrolase [Handroan... 75 6e-13 ref|XP_011078334.1| palmitoyl-acyl carrier protein thioesterase,... 75 6e-13 gb|EPS63635.1| hypothetical protein M569_11148, partial [Genlise... 70 2e-11 gb|KZV27454.1| palmitoyl-acyl carrier protein thioesterase, chlo... 70 3e-11 ref|XP_022897600.1| palmitoyl-acyl carrier protein thioesterase,... 70 4e-11 gb|AIU99497.1| Acyl-ACP Thioesterase B [Salvia miltiorrhiza] 69 6e-11 ref|XP_012854562.1| PREDICTED: palmitoyl-acyl carrier protein th... 69 6e-11 ref|XP_022899586.1| palmitoyl-acyl carrier protein thioesterase,... 69 9e-11 ref|XP_022899585.1| palmitoyl-acyl carrier protein thioesterase,... 69 1e-10 emb|CDP20806.1| unnamed protein product [Coffea canephora] 67 3e-10 gb|KZV14523.1| palmitoyl-acyl carrier protein thioesterase, chlo... 67 3e-10 ref|XP_019173239.1| PREDICTED: palmitoyl-acyl carrier protein th... 67 5e-10 gb|ACQ57187.1| acyl acyl-carrier-protein thioesterase type B [Ca... 67 5e-10 ref|XP_022899588.1| palmitoyl-acyl carrier protein thioesterase,... 66 7e-10 gb|AAX51637.1| chloroplast stearoyl/oleoyl specific acyl-acyl ca... 66 8e-10 ref|XP_022899587.1| palmitoyl-acyl carrier protein thioesterase,... 66 8e-10 ref|XP_006366870.1| PREDICTED: palmitoyl-acyl carrier protein th... 65 2e-09 gb|PHU07993.1| Palmitoyl-acyl carrier protein thioesterase, chlo... 65 2e-09 gb|PHT51958.1| Palmitoyl-acyl carrier protein thioesterase, chlo... 65 2e-09 ref|NP_001311523.1| palmitoyl-acyl carrier protein thioesterase,... 65 2e-09 >gb|PIN09179.1| Oleoyl-[acyl-carrier-protein] hydrolase [Handroanthus impetiginosus] Length = 423 Score = 75.1 bits (183), Expect = 6e-13 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +2 Query: 329 SLWVMMNKETRRLSKIPDEVREEIGGYFVDSPPIV 433 SLWVMMNKETRRLSKIPDEVREEIGGYFVDSPPIV Sbjct: 254 SLWVMMNKETRRLSKIPDEVREEIGGYFVDSPPIV 288 >ref|XP_011078334.1| palmitoyl-acyl carrier protein thioesterase, chloroplastic [Sesamum indicum] ref|XP_011078335.1| palmitoyl-acyl carrier protein thioesterase, chloroplastic [Sesamum indicum] ref|XP_011078336.1| palmitoyl-acyl carrier protein thioesterase, chloroplastic [Sesamum indicum] ref|XP_011078337.1| palmitoyl-acyl carrier protein thioesterase, chloroplastic [Sesamum indicum] Length = 424 Score = 75.1 bits (183), Expect = 6e-13 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +2 Query: 329 SLWVMMNKETRRLSKIPDEVREEIGGYFVDSPPIV 433 SLWVMMNKETRRLSKIPDEVREEIGGYFVDSPPIV Sbjct: 255 SLWVMMNKETRRLSKIPDEVREEIGGYFVDSPPIV 289 >gb|EPS63635.1| hypothetical protein M569_11148, partial [Genlisea aurea] Length = 379 Score = 70.5 bits (171), Expect = 2e-11 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +2 Query: 329 SLWVMMNKETRRLSKIPDEVREEIGGYFVDSPPIV 433 S+WVMMNKETR+LSKIPDEVR EIGGYFVDSPPI+ Sbjct: 233 SVWVMMNKETRKLSKIPDEVRSEIGGYFVDSPPII 267 >gb|KZV27454.1| palmitoyl-acyl carrier protein thioesterase, chloroplastic-like [Dorcoceras hygrometricum] Length = 479 Score = 70.1 bits (170), Expect = 3e-11 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +2 Query: 329 SLWVMMNKETRRLSKIPDEVREEIGGYFVDSPPIV 433 S WVMMNKETRRL+KIPDEVR+EIGGYFVDSPP+V Sbjct: 333 SQWVMMNKETRRLAKIPDEVRDEIGGYFVDSPPVV 367 >ref|XP_022897600.1| palmitoyl-acyl carrier protein thioesterase, chloroplastic-like [Olea europaea var. sylvestris] Length = 424 Score = 69.7 bits (169), Expect = 4e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +2 Query: 329 SLWVMMNKETRRLSKIPDEVREEIGGYFVDSPPIV 433 SLWVMMNKETRRL+KIPDEVREEIGGYFVDS P+V Sbjct: 255 SLWVMMNKETRRLAKIPDEVREEIGGYFVDSLPVV 289 >gb|AIU99497.1| Acyl-ACP Thioesterase B [Salvia miltiorrhiza] Length = 422 Score = 69.3 bits (168), Expect = 6e-11 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = +2 Query: 329 SLWVMMNKETRRLSKIPDEVREEIGGYFVDSPPIV 433 SLWVMMNKETRRLSKIPDEVR EIG YFVDSPP+V Sbjct: 253 SLWVMMNKETRRLSKIPDEVRGEIGSYFVDSPPLV 287 >ref|XP_012854562.1| PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic [Erythranthe guttata] ref|XP_012854563.1| PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic [Erythranthe guttata] ref|XP_012854564.1| PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic [Erythranthe guttata] ref|XP_012854565.1| PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic [Erythranthe guttata] ref|XP_012854566.1| PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic [Erythranthe guttata] ref|XP_012854567.1| PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic [Erythranthe guttata] ref|XP_012854568.1| PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic [Erythranthe guttata] ref|XP_012854569.1| PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic [Erythranthe guttata] ref|XP_012854570.1| PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic [Erythranthe guttata] gb|EYU23034.1| hypothetical protein MIMGU_mgv1a007000mg [Erythranthe guttata] gb|EYU23035.1| hypothetical protein MIMGU_mgv1a007000mg [Erythranthe guttata] gb|EYU23036.1| hypothetical protein MIMGU_mgv1a007000mg [Erythranthe guttata] gb|EYU23037.1| hypothetical protein MIMGU_mgv1a007000mg [Erythranthe guttata] gb|EYU23038.1| hypothetical protein MIMGU_mgv1a007000mg [Erythranthe guttata] Length = 423 Score = 69.3 bits (168), Expect = 6e-11 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = +2 Query: 329 SLWVMMNKETRRLSKIPDEVREEIGGYFVDSPPIV 433 SLWVMMNK TRRLSKIPDEVR+EI GYFVDSPPIV Sbjct: 254 SLWVMMNKATRRLSKIPDEVRDEIAGYFVDSPPIV 288 >ref|XP_022899586.1| palmitoyl-acyl carrier protein thioesterase, chloroplastic-like isoform X2 [Olea europaea var. sylvestris] Length = 352 Score = 68.6 bits (166), Expect = 9e-11 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +2 Query: 329 SLWVMMNKETRRLSKIPDEVREEIGGYFVDSPPIV 433 S+WVMMNKETRRL+KIPDEVREEIGGYFVDS P+V Sbjct: 183 SVWVMMNKETRRLAKIPDEVREEIGGYFVDSLPVV 217 >ref|XP_022899585.1| palmitoyl-acyl carrier protein thioesterase, chloroplastic-like isoform X1 [Olea europaea var. sylvestris] Length = 422 Score = 68.6 bits (166), Expect = 1e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +2 Query: 329 SLWVMMNKETRRLSKIPDEVREEIGGYFVDSPPIV 433 S+WVMMNKETRRL+KIPDEVREEIGGYFVDS P+V Sbjct: 253 SVWVMMNKETRRLAKIPDEVREEIGGYFVDSLPVV 287 >emb|CDP20806.1| unnamed protein product [Coffea canephora] Length = 418 Score = 67.4 bits (163), Expect = 3e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +2 Query: 329 SLWVMMNKETRRLSKIPDEVREEIGGYFVDSPPIV 433 SLWVMMNKETRRLSKIPDEVR EI GY++DSPPIV Sbjct: 249 SLWVMMNKETRRLSKIPDEVRAEIEGYYLDSPPIV 283 >gb|KZV14523.1| palmitoyl-acyl carrier protein thioesterase, chloroplastic [Dorcoceras hygrometricum] Length = 420 Score = 67.4 bits (163), Expect = 3e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +2 Query: 329 SLWVMMNKETRRLSKIPDEVREEIGGYFVDSPPIV 433 SLWVMMNKETR+LSKIP+EVREEIG YFVD PP+V Sbjct: 254 SLWVMMNKETRKLSKIPEEVREEIGSYFVDYPPVV 288 >ref|XP_019173239.1| PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic-like [Ipomoea nil] ref|XP_019173240.1| PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic-like [Ipomoea nil] ref|XP_019173241.1| PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic-like [Ipomoea nil] Length = 422 Score = 66.6 bits (161), Expect = 5e-10 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +2 Query: 329 SLWVMMNKETRRLSKIPDEVREEIGGYFVDSPPIV 433 SLWVMMNKETRRL+K+PDEVR EIG YFVD+PPI+ Sbjct: 253 SLWVMMNKETRRLAKMPDEVRAEIGSYFVDTPPII 287 >gb|ACQ57187.1| acyl acyl-carrier-protein thioesterase type B [Camellia oleifera] Length = 423 Score = 66.6 bits (161), Expect = 5e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +2 Query: 329 SLWVMMNKETRRLSKIPDEVREEIGGYFVDSPPIV 433 S+WVMMNKETRRLSKIPDEVR EIG YFVDSPP++ Sbjct: 251 SVWVMMNKETRRLSKIPDEVRVEIGPYFVDSPPVL 285 >ref|XP_022899588.1| palmitoyl-acyl carrier protein thioesterase, chloroplastic-like isoform X2 [Olea europaea var. sylvestris] Length = 304 Score = 65.9 bits (159), Expect = 7e-10 Identities = 28/35 (80%), Positives = 34/35 (97%) Frame = +2 Query: 329 SLWVMMNKETRRLSKIPDEVREEIGGYFVDSPPIV 433 S WVM++KETR+L+K+PDEVREEIGGYFVDSPP+V Sbjct: 187 SQWVMLHKETRKLAKMPDEVREEIGGYFVDSPPVV 221 >gb|AAX51637.1| chloroplast stearoyl/oleoyl specific acyl-acyl carrier protein thioesterase precursor, partial [Madhuca longifolia var. latifolia] Length = 333 Score = 65.9 bits (159), Expect = 8e-10 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +2 Query: 329 SLWVMMNKETRRLSKIPDEVREEIGGYFVDSPPIV 433 S+WVMMN+ETRRLSKIPDEVR EIG YFVDSPP++ Sbjct: 164 SVWVMMNRETRRLSKIPDEVRLEIGSYFVDSPPVL 198 >ref|XP_022899587.1| palmitoyl-acyl carrier protein thioesterase, chloroplastic-like isoform X1 [Olea europaea var. sylvestris] Length = 349 Score = 65.9 bits (159), Expect = 8e-10 Identities = 28/35 (80%), Positives = 34/35 (97%) Frame = +2 Query: 329 SLWVMMNKETRRLSKIPDEVREEIGGYFVDSPPIV 433 S WVM++KETR+L+K+PDEVREEIGGYFVDSPP+V Sbjct: 187 SQWVMLHKETRKLAKMPDEVREEIGGYFVDSPPVV 221 >ref|XP_006366870.1| PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic [Solanum tuberosum] Length = 420 Score = 65.1 bits (157), Expect = 2e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +2 Query: 329 SLWVMMNKETRRLSKIPDEVREEIGGYFVDSPPIV 433 S WVMMNKETRRLSKIPDE R EI GYFVDSPP++ Sbjct: 253 SQWVMMNKETRRLSKIPDEARAEIEGYFVDSPPVI 287 >gb|PHU07993.1| Palmitoyl-acyl carrier protein thioesterase, chloroplastic [Capsicum chinense] Length = 421 Score = 65.1 bits (157), Expect = 2e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +2 Query: 329 SLWVMMNKETRRLSKIPDEVREEIGGYFVDSPPIV 433 S WVMMNKETRRLSKIPDE R EI GYFVDSPP++ Sbjct: 254 SQWVMMNKETRRLSKIPDEARAEIEGYFVDSPPVI 288 >gb|PHT51958.1| Palmitoyl-acyl carrier protein thioesterase, chloroplastic [Capsicum baccatum] Length = 421 Score = 65.1 bits (157), Expect = 2e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +2 Query: 329 SLWVMMNKETRRLSKIPDEVREEIGGYFVDSPPIV 433 S WVMMNKETRRLSKIPDE R EI GYFVDSPP++ Sbjct: 254 SQWVMMNKETRRLSKIPDEARAEIEGYFVDSPPVI 288 >ref|NP_001311523.1| palmitoyl-acyl carrier protein thioesterase, chloroplastic [Capsicum annuum] ref|XP_016541082.1| PREDICTED: palmitoyl-acyl carrier protein thioesterase, chloroplastic [Capsicum annuum] gb|ACF17654.1| putative acyl-ACP thioesterase B [Capsicum annuum] gb|PHT73388.1| Palmitoyl-acyl carrier protein thioesterase, chloroplastic [Capsicum annuum] Length = 421 Score = 65.1 bits (157), Expect = 2e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +2 Query: 329 SLWVMMNKETRRLSKIPDEVREEIGGYFVDSPPIV 433 S WVMMNKETRRLSKIPDE R EI GYFVDSPP++ Sbjct: 254 SQWVMMNKETRRLSKIPDEARAEIEGYFVDSPPVI 288