BLASTX nr result
ID: Rehmannia30_contig00023875
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00023875 (387 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012850857.1| PREDICTED: clathrin light chain 1-like [Eryt... 75 2e-13 ref|XP_011085970.1| clathrin light chain 1 [Sesamum indicum] 74 7e-13 gb|PIN06267.1| Vesicle coat protein clathrin, light chain [Handr... 69 3e-11 >ref|XP_012850857.1| PREDICTED: clathrin light chain 1-like [Erythranthe guttata] Length = 368 Score = 75.5 bits (184), Expect = 2e-13 Identities = 44/75 (58%), Positives = 52/75 (69%), Gaps = 11/75 (14%) Frame = +1 Query: 55 ATPKASEDGKEGKNGKD---ANTVASP-------KPTSPAKDAAKSATPKTPKPDEPS-A 201 ATPKASE+GK+GK+GKD A A+P K SP+KDAAKS TPKTPK DE S Sbjct: 294 ATPKASEEGKDGKDGKDVKEATPKAAPAAGEKGEKAVSPSKDAAKSVTPKTPKTDESSVT 353 Query: 202 TEAEENVEKESSTIA 246 TE ++N E ESST+A Sbjct: 354 TEGKQNPETESSTVA 368 >ref|XP_011085970.1| clathrin light chain 1 [Sesamum indicum] Length = 367 Score = 73.9 bits (180), Expect = 7e-13 Identities = 39/68 (57%), Positives = 46/68 (67%), Gaps = 4/68 (5%) Frame = +1 Query: 55 ATPKASEDGKEGKNGKDA----NTVASPKPTSPAKDAAKSATPKTPKPDEPSATEAEENV 222 ATPKA +DGK+ K GK+A +T A P SPAKDAAK ATPKT K DE SA E ++ + Sbjct: 300 ATPKALQDGKDNKGGKEATSSASTAAGETPISPAKDAAKGATPKTTKSDESSAVEGKQYI 359 Query: 223 EKESSTIA 246 E E S IA Sbjct: 360 ENEPSLIA 367 >gb|PIN06267.1| Vesicle coat protein clathrin, light chain [Handroanthus impetiginosus] Length = 352 Score = 69.3 bits (168), Expect = 3e-11 Identities = 37/64 (57%), Positives = 42/64 (65%) Frame = +1 Query: 55 ATPKASEDGKEGKNGKDANTVASPKPTSPAKDAAKSATPKTPKPDEPSATEAEENVEKES 234 ATPKASE K+ K A+ + KP SP KDAAK ATPKTPKPDE S TE +N E + Sbjct: 291 ATPKASEGVKDA--AKPASPASGAKPVSPTKDAAKVATPKTPKPDESSTTEGTQNEENDP 348 Query: 235 STIA 246 S IA Sbjct: 349 SIIA 352