BLASTX nr result
ID: Rehmannia30_contig00023730
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00023730 (421 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019053634.1| PREDICTED: uncharacterized protein LOC104599... 65 4e-10 gb|PHT74392.1| hypothetical protein T459_21669 [Capsicum annuum] 62 2e-09 ref|XP_021641273.1| 54S ribosomal protein L24, mitochondrial-lik... 63 3e-09 ref|XP_022729910.1| 54S ribosomal protein L24, mitochondrial-lik... 63 4e-09 gb|OVA00906.1| Ribosomal protein L28 [Macleaya cordata] 63 4e-09 ref|XP_022145425.1| uncharacterized protein LOC111014872 [Momord... 63 4e-09 ref|XP_018817624.1| PREDICTED: uncharacterized protein LOC108988... 63 4e-09 ref|XP_021834743.1| 39S ribosomal protein L28, mitochondrial [Pr... 63 5e-09 ref|XP_007226092.1| 54S ribosomal protein L24, mitochondrial [Pr... 63 5e-09 ref|XP_023875293.1| 54S ribosomal protein L24, mitochondrial-lik... 62 5e-09 ref|XP_023887974.1| 54S ribosomal protein L24, mitochondrial [Qu... 62 5e-09 ref|XP_009348469.1| PREDICTED: 54S ribosomal protein L24, mitoch... 63 5e-09 ref|XP_009363622.1| PREDICTED: uncharacterized protein LOC103953... 63 5e-09 ref|XP_009353347.1| PREDICTED: 54S ribosomal protein L24, mitoch... 63 5e-09 ref|XP_008347653.1| PREDICTED: 54S ribosomal protein L24, mitoch... 63 5e-09 ref|XP_008393956.1| PREDICTED: uncharacterized protein LOC103456... 63 5e-09 ref|XP_021637440.1| 54S ribosomal protein L24, mitochondrial-lik... 62 5e-09 ref|XP_021598353.1| 54S ribosomal protein L24, mitochondrial-lik... 62 5e-09 gb|POO03836.1| Ribosomal protein [Trema orientalis] 62 5e-09 gb|PON73037.1| Ribosomal protein [Parasponia andersonii] 62 5e-09 >ref|XP_019053634.1| PREDICTED: uncharacterized protein LOC104599128 isoform X2 [Nelumbo nucifera] Length = 181 Score = 64.7 bits (156), Expect = 4e-10 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = +2 Query: 302 SPLHCRARRTWKPNVEEKKLFSYILDRHIRVKVTTPELR 418 S L R RRTWKPNV+EK+LFSYILDRHIRVKVTT LR Sbjct: 6 SSLVTRTRRTWKPNVQEKRLFSYILDRHIRVKVTTHALR 44 >gb|PHT74392.1| hypothetical protein T459_21669 [Capsicum annuum] Length = 147 Score = 62.4 bits (150), Expect = 2e-09 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +2 Query: 317 RARRTWKPNVEEKKLFSYILDRHIRVKVTTPELR 418 R+RR+WKPNV+EK+LFSYILDRHIRVKVTT LR Sbjct: 3 RSRRSWKPNVQEKRLFSYILDRHIRVKVTTHALR 36 >ref|XP_021641273.1| 54S ribosomal protein L24, mitochondrial-like [Hevea brasiliensis] ref|XP_021641274.1| 54S ribosomal protein L24, mitochondrial-like [Hevea brasiliensis] Length = 211 Score = 62.8 bits (151), Expect = 3e-09 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +2 Query: 317 RARRTWKPNVEEKKLFSYILDRHIRVKVTTPELR 418 ++RRTWKPNV+EK+LFSYILDRHIRVKVTT LR Sbjct: 66 KSRRTWKPNVQEKRLFSYILDRHIRVKVTTHALR 99 >ref|XP_022729910.1| 54S ribosomal protein L24, mitochondrial-like [Durio zibethinus] Length = 219 Score = 62.8 bits (151), Expect = 4e-09 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +2 Query: 317 RARRTWKPNVEEKKLFSYILDRHIRVKVTTPELR 418 ++RRTWKPNV+EK+LFSYILDRHIRVKVTT LR Sbjct: 66 KSRRTWKPNVQEKRLFSYILDRHIRVKVTTHALR 99 >gb|OVA00906.1| Ribosomal protein L28 [Macleaya cordata] Length = 220 Score = 62.8 bits (151), Expect = 4e-09 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +2 Query: 317 RARRTWKPNVEEKKLFSYILDRHIRVKVTTPELR 418 ++RRTWKPNV+EK+LFSYILDRHIRVKVTT LR Sbjct: 66 KSRRTWKPNVQEKRLFSYILDRHIRVKVTTHALR 99 >ref|XP_022145425.1| uncharacterized protein LOC111014872 [Momordica charantia] Length = 221 Score = 62.8 bits (151), Expect = 4e-09 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +2 Query: 317 RARRTWKPNVEEKKLFSYILDRHIRVKVTTPELR 418 ++RRTWKPNV+EK+LFSYILDRHIRVKVTT LR Sbjct: 66 KSRRTWKPNVQEKRLFSYILDRHIRVKVTTHALR 99 >ref|XP_018817624.1| PREDICTED: uncharacterized protein LOC108988738 [Juglans regia] Length = 221 Score = 62.8 bits (151), Expect = 4e-09 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +2 Query: 317 RARRTWKPNVEEKKLFSYILDRHIRVKVTTPELR 418 ++RRTWKPNV+EK+LFSYILDRHIRVKVTT LR Sbjct: 67 KSRRTWKPNVQEKRLFSYILDRHIRVKVTTHALR 100 >ref|XP_021834743.1| 39S ribosomal protein L28, mitochondrial [Prunus avium] Length = 235 Score = 62.8 bits (151), Expect = 5e-09 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +2 Query: 317 RARRTWKPNVEEKKLFSYILDRHIRVKVTTPELR 418 ++RRTWKPNV+EK+LFSYILDRHIRVKVTT LR Sbjct: 86 KSRRTWKPNVQEKRLFSYILDRHIRVKVTTHALR 119 >ref|XP_007226092.1| 54S ribosomal protein L24, mitochondrial [Prunus persica] gb|ONI34032.1| hypothetical protein PRUPE_1G459900 [Prunus persica] Length = 235 Score = 62.8 bits (151), Expect = 5e-09 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +2 Query: 317 RARRTWKPNVEEKKLFSYILDRHIRVKVTTPELR 418 ++RRTWKPNV+EK+LFSYILDRHIRVKVTT LR Sbjct: 86 KSRRTWKPNVQEKRLFSYILDRHIRVKVTTHALR 119 >ref|XP_023875293.1| 54S ribosomal protein L24, mitochondrial-like [Quercus suber] ref|XP_023875294.1| 54S ribosomal protein L24, mitochondrial-like [Quercus suber] ref|XP_023875295.1| 54S ribosomal protein L24, mitochondrial-like [Quercus suber] ref|XP_023875296.1| 54S ribosomal protein L24, mitochondrial-like [Quercus suber] ref|XP_023875297.1| 54S ribosomal protein L24, mitochondrial-like [Quercus suber] ref|XP_023875298.1| 54S ribosomal protein L24, mitochondrial-like [Quercus suber] ref|XP_023875299.1| 54S ribosomal protein L24, mitochondrial-like [Quercus suber] ref|XP_023875300.1| 54S ribosomal protein L24, mitochondrial-like [Quercus suber] ref|XP_023875301.1| 54S ribosomal protein L24, mitochondrial-like [Quercus suber] gb|POE82537.1| 54s ribosomal protein l24, mitochondrial [Quercus suber] Length = 209 Score = 62.4 bits (150), Expect = 5e-09 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +2 Query: 317 RARRTWKPNVEEKKLFSYILDRHIRVKVTTPELR 418 ++RRTWKPNV+EK+LFSY+LDRHIRVKVTT LR Sbjct: 66 KSRRTWKPNVQEKRLFSYVLDRHIRVKVTTHALR 99 >ref|XP_023887974.1| 54S ribosomal protein L24, mitochondrial [Quercus suber] gb|POE66762.1| 54s ribosomal protein l24, mitochondrial [Quercus suber] Length = 209 Score = 62.4 bits (150), Expect = 5e-09 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +2 Query: 317 RARRTWKPNVEEKKLFSYILDRHIRVKVTTPELR 418 ++RRTWKPNV+EK+LFSY+LDRHIRVKVTT LR Sbjct: 66 KSRRTWKPNVQEKRLFSYVLDRHIRVKVTTHALR 99 >ref|XP_009348469.1| PREDICTED: 54S ribosomal protein L24, mitochondrial-like [Pyrus x bretschneideri] Length = 237 Score = 62.8 bits (151), Expect = 5e-09 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +2 Query: 317 RARRTWKPNVEEKKLFSYILDRHIRVKVTTPELR 418 ++RRTWKPNV+EK+LFSYILDRHIRVKVTT LR Sbjct: 86 KSRRTWKPNVQEKRLFSYILDRHIRVKVTTHALR 119 >ref|XP_009363622.1| PREDICTED: uncharacterized protein LOC103953584 [Pyrus x bretschneideri] ref|XP_009368002.1| PREDICTED: uncharacterized protein LOC103957543 [Pyrus x bretschneideri] Length = 238 Score = 62.8 bits (151), Expect = 5e-09 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +2 Query: 317 RARRTWKPNVEEKKLFSYILDRHIRVKVTTPELR 418 ++RRTWKPNV+EK+LFSYILDRHIRVKVTT LR Sbjct: 87 KSRRTWKPNVQEKRLFSYILDRHIRVKVTTHALR 120 >ref|XP_009353347.1| PREDICTED: 54S ribosomal protein L24, mitochondrial-like [Pyrus x bretschneideri] Length = 238 Score = 62.8 bits (151), Expect = 5e-09 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +2 Query: 317 RARRTWKPNVEEKKLFSYILDRHIRVKVTTPELR 418 ++RRTWKPNV+EK+LFSYILDRHIRVKVTT LR Sbjct: 87 KSRRTWKPNVQEKRLFSYILDRHIRVKVTTHALR 120 >ref|XP_008347653.1| PREDICTED: 54S ribosomal protein L24, mitochondrial-like [Malus domestica] ref|XP_008347654.1| PREDICTED: 54S ribosomal protein L24, mitochondrial-like [Malus domestica] ref|XP_017181133.1| PREDICTED: 54S ribosomal protein L24, mitochondrial-like [Malus domestica] Length = 238 Score = 62.8 bits (151), Expect = 5e-09 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +2 Query: 317 RARRTWKPNVEEKKLFSYILDRHIRVKVTTPELR 418 ++RRTWKPNV+EK+LFSYILDRHIRVKVTT LR Sbjct: 87 KSRRTWKPNVQEKRLFSYILDRHIRVKVTTHALR 120 >ref|XP_008393956.1| PREDICTED: uncharacterized protein LOC103456099 [Malus domestica] Length = 238 Score = 62.8 bits (151), Expect = 5e-09 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +2 Query: 317 RARRTWKPNVEEKKLFSYILDRHIRVKVTTPELR 418 ++RRTWKPNV+EK+LFSYILDRHIRVKVTT LR Sbjct: 87 KSRRTWKPNVQEKRLFSYILDRHIRVKVTTHALR 120 >ref|XP_021637440.1| 54S ribosomal protein L24, mitochondrial-like [Hevea brasiliensis] ref|XP_021637443.1| 54S ribosomal protein L24, mitochondrial-like [Hevea brasiliensis] Length = 211 Score = 62.4 bits (150), Expect = 5e-09 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +2 Query: 317 RARRTWKPNVEEKKLFSYILDRHIRVKVTTPELR 418 ++RRTWKPNV+EK+LFSYILDRH+RVKVTT LR Sbjct: 66 KSRRTWKPNVQEKRLFSYILDRHVRVKVTTHALR 99 >ref|XP_021598353.1| 54S ribosomal protein L24, mitochondrial-like [Manihot esculenta] ref|XP_021598354.1| 54S ribosomal protein L24, mitochondrial-like [Manihot esculenta] gb|OAY25345.1| hypothetical protein MANES_17G086700 [Manihot esculenta] gb|OAY25346.1| hypothetical protein MANES_17G086700 [Manihot esculenta] Length = 211 Score = 62.4 bits (150), Expect = 5e-09 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +2 Query: 317 RARRTWKPNVEEKKLFSYILDRHIRVKVTTPELR 418 + RRTWKPNV+EK+LFSYILDRHIRVKVTT LR Sbjct: 66 KTRRTWKPNVQEKRLFSYILDRHIRVKVTTHALR 99 >gb|POO03836.1| Ribosomal protein [Trema orientalis] Length = 218 Score = 62.4 bits (150), Expect = 5e-09 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +2 Query: 317 RARRTWKPNVEEKKLFSYILDRHIRVKVTTPELR 418 + RRTWKPNV+EK+LFSYILDRHIRVKVTT LR Sbjct: 66 KTRRTWKPNVQEKRLFSYILDRHIRVKVTTHALR 99 >gb|PON73037.1| Ribosomal protein [Parasponia andersonii] Length = 218 Score = 62.4 bits (150), Expect = 5e-09 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +2 Query: 317 RARRTWKPNVEEKKLFSYILDRHIRVKVTTPELR 418 + RRTWKPNV+EK+LFSYILDRHIRVKVTT LR Sbjct: 66 KTRRTWKPNVQEKRLFSYILDRHIRVKVTTHALR 99