BLASTX nr result
ID: Rehmannia30_contig00023596
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00023596 (508 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011100508.1| probable phosphopantothenoylcysteine decarbo... 223 2e-71 ref|XP_022874703.1| probable phosphopantothenoylcysteine decarbo... 222 5e-71 ref|XP_012854792.1| PREDICTED: probable phosphopantothenoylcyste... 221 1e-70 ref|XP_012854793.1| PREDICTED: probable phosphopantothenoylcyste... 220 4e-70 ref|XP_012842340.1| PREDICTED: probable phosphopantothenoylcyste... 218 2e-69 ref|XP_018811471.1| PREDICTED: probable phosphopantothenoylcyste... 217 7e-69 ref|XP_011097200.1| probable phosphopantothenoylcysteine decarbo... 215 7e-68 ref|XP_020547719.1| probable phosphopantothenoylcysteine decarbo... 215 1e-67 ref|XP_011097175.1| probable phosphopantothenoylcysteine decarbo... 213 2e-67 ref|XP_006476954.1| PREDICTED: phosphopantothenoylcysteine decar... 213 2e-67 ref|XP_006440019.1| phosphopantothenoylcysteine decarboxylase [C... 212 7e-67 dbj|GAY50991.1| hypothetical protein CUMW_130870 [Citrus unshiu] 213 2e-66 ref|XP_010036009.1| PREDICTED: probable phosphopantothenoylcyste... 210 3e-66 ref|XP_012075726.1| probable phosphopantothenoylcysteine decarbo... 210 3e-66 ref|XP_019264197.1| PREDICTED: probable phosphopantothenoylcyste... 209 5e-66 ref|XP_002526282.1| PREDICTED: phosphopantothenoylcysteine decar... 209 5e-66 ref|XP_016752257.1| PREDICTED: phosphopantothenoylcysteine decar... 209 7e-66 ref|XP_022772747.1| phosphopantothenoylcysteine decarboxylase-li... 209 1e-65 ref|XP_021678000.1| probable phosphopantothenoylcysteine decarbo... 208 2e-65 ref|XP_016488075.1| PREDICTED: probable phosphopantothenoylcyste... 207 3e-65 >ref|XP_011100508.1| probable phosphopantothenoylcysteine decarboxylase [Sesamum indicum] Length = 211 Score = 223 bits (569), Expect = 2e-71 Identities = 108/126 (85%), Positives = 113/126 (89%) Frame = +1 Query: 130 MAHLEPANTDMNLYQVRNGPRKPRILLAASGSVAAMKFSNLCHCFSEWAEVKAVATKASL 309 M H EP + DM LYQV N RKPRILLAASGSVAA+KF+NLCHCFSEWAEVKAVATKASL Sbjct: 1 MVHSEPPSADMQLYQVNNASRKPRILLAASGSVAAIKFANLCHCFSEWAEVKAVATKASL 60 Query: 310 HFVDIVSLPKDVILYTDEDEWSTWKKIGDSVLHIELRKWADIMVIAPLSANTLAKIAGGF 489 HFVD VS+PKDV LYTDEDEWS+W KIGDSVLHIELRKWADIMVIAPLSANTL KIAGG Sbjct: 61 HFVDRVSVPKDVTLYTDEDEWSSWNKIGDSVLHIELRKWADIMVIAPLSANTLGKIAGGL 120 Query: 490 CDNLLT 507 CDNLLT Sbjct: 121 CDNLLT 126 >ref|XP_022874703.1| probable phosphopantothenoylcysteine decarboxylase [Olea europaea var. sylvestris] ref|XP_022874704.1| probable phosphopantothenoylcysteine decarboxylase [Olea europaea var. sylvestris] Length = 212 Score = 222 bits (566), Expect = 5e-71 Identities = 106/126 (84%), Positives = 115/126 (91%) Frame = +1 Query: 130 MAHLEPANTDMNLYQVRNGPRKPRILLAASGSVAAMKFSNLCHCFSEWAEVKAVATKASL 309 MA LEPA+ D L+QV +G R+PRILLAASGSVAA+KF+NLCHCFSEWAEVKAVATKAS+ Sbjct: 1 MAQLEPASADRELFQVYSGARRPRILLAASGSVAAIKFANLCHCFSEWAEVKAVATKASM 60 Query: 310 HFVDIVSLPKDVILYTDEDEWSTWKKIGDSVLHIELRKWADIMVIAPLSANTLAKIAGGF 489 HF+D SLPKDV LYTDEDEWSTWKKIGDSVLHIELR+WADIMVIAPLSANTL KIAGG Sbjct: 61 HFIDTTSLPKDVTLYTDEDEWSTWKKIGDSVLHIELRRWADIMVIAPLSANTLGKIAGGL 120 Query: 490 CDNLLT 507 CDNLLT Sbjct: 121 CDNLLT 126 >ref|XP_012854792.1| PREDICTED: probable phosphopantothenoylcysteine decarboxylase isoform X1 [Erythranthe guttata] Length = 217 Score = 221 bits (564), Expect = 1e-70 Identities = 107/127 (84%), Positives = 116/127 (91%) Frame = +1 Query: 127 VMAHLEPANTDMNLYQVRNGPRKPRILLAASGSVAAMKFSNLCHCFSEWAEVKAVATKAS 306 VMAH+EPANTDMN+Y + P KPRILLAASGSVAA+KF+NLCHCFSEWAEVKAVATKAS Sbjct: 7 VMAHVEPANTDMNVYH--SAPTKPRILLAASGSVAAIKFANLCHCFSEWAEVKAVATKAS 64 Query: 307 LHFVDIVSLPKDVILYTDEDEWSTWKKIGDSVLHIELRKWADIMVIAPLSANTLAKIAGG 486 LHFVD SLPKDV LYTDE+EWSTW K+GDSVLHIELR+WADIMVIAPLSANTL KIAGG Sbjct: 65 LHFVDRASLPKDVTLYTDEEEWSTWNKLGDSVLHIELRRWADIMVIAPLSANTLGKIAGG 124 Query: 487 FCDNLLT 507 CDNL+T Sbjct: 125 LCDNLVT 131 >ref|XP_012854793.1| PREDICTED: probable phosphopantothenoylcysteine decarboxylase isoform X2 [Erythranthe guttata] gb|EYU22858.1| hypothetical protein MIMGU_mgv1a025531mg [Erythranthe guttata] Length = 210 Score = 220 bits (560), Expect = 4e-70 Identities = 106/126 (84%), Positives = 115/126 (91%) Frame = +1 Query: 130 MAHLEPANTDMNLYQVRNGPRKPRILLAASGSVAAMKFSNLCHCFSEWAEVKAVATKASL 309 MAH+EPANTDMN+Y + P KPRILLAASGSVAA+KF+NLCHCFSEWAEVKAVATKASL Sbjct: 1 MAHVEPANTDMNVYH--SAPTKPRILLAASGSVAAIKFANLCHCFSEWAEVKAVATKASL 58 Query: 310 HFVDIVSLPKDVILYTDEDEWSTWKKIGDSVLHIELRKWADIMVIAPLSANTLAKIAGGF 489 HFVD SLPKDV LYTDE+EWSTW K+GDSVLHIELR+WADIMVIAPLSANTL KIAGG Sbjct: 59 HFVDRASLPKDVTLYTDEEEWSTWNKLGDSVLHIELRRWADIMVIAPLSANTLGKIAGGL 118 Query: 490 CDNLLT 507 CDNL+T Sbjct: 119 CDNLVT 124 >ref|XP_012842340.1| PREDICTED: probable phosphopantothenoylcysteine decarboxylase [Erythranthe guttata] gb|EYU33304.1| hypothetical protein MIMGU_mgv1a013844mg [Erythranthe guttata] Length = 209 Score = 218 bits (556), Expect = 2e-69 Identities = 110/127 (86%), Positives = 115/127 (90%), Gaps = 1/127 (0%) Frame = +1 Query: 130 MAHLEPANTDMNLYQVRNGP-RKPRILLAASGSVAAMKFSNLCHCFSEWAEVKAVATKAS 306 MAHLE ANTD+NLY NG RKPRILLAASGSVAA+KF+NLCHCFSEWAEVKAVATKAS Sbjct: 1 MAHLESANTDVNLY---NGTSRKPRILLAASGSVAAIKFANLCHCFSEWAEVKAVATKAS 57 Query: 307 LHFVDIVSLPKDVILYTDEDEWSTWKKIGDSVLHIELRKWADIMVIAPLSANTLAKIAGG 486 LHFVD SLPKDV LYTDEDEWSTWKKIGD VLHIELR+WADIMVIAPLSANTL KIAGG Sbjct: 58 LHFVDRASLPKDVTLYTDEDEWSTWKKIGDGVLHIELRRWADIMVIAPLSANTLGKIAGG 117 Query: 487 FCDNLLT 507 CDNLL+ Sbjct: 118 LCDNLLS 124 >ref|XP_018811471.1| PREDICTED: probable phosphopantothenoylcysteine decarboxylase [Juglans regia] ref|XP_018811472.1| PREDICTED: probable phosphopantothenoylcysteine decarboxylase [Juglans regia] Length = 212 Score = 217 bits (552), Expect = 7e-69 Identities = 105/126 (83%), Positives = 113/126 (89%) Frame = +1 Query: 130 MAHLEPANTDMNLYQVRNGPRKPRILLAASGSVAAMKFSNLCHCFSEWAEVKAVATKASL 309 MA EP N + + QV PRKPRILLAASGSVAA+KFSNLCHCFSEWAEVKAVAT+ASL Sbjct: 1 MAGSEPVNVERDPIQVNGTPRKPRILLAASGSVAAIKFSNLCHCFSEWAEVKAVATQASL 60 Query: 310 HFVDIVSLPKDVILYTDEDEWSTWKKIGDSVLHIELRKWADIMVIAPLSANTLAKIAGGF 489 HF+D VSLPKDV+LYTDEDEWS+WKKIGDSVLHIELR+WADIMVIAPLSANTL KIAGG Sbjct: 61 HFIDRVSLPKDVVLYTDEDEWSSWKKIGDSVLHIELRRWADIMVIAPLSANTLGKIAGGL 120 Query: 490 CDNLLT 507 CDNLLT Sbjct: 121 CDNLLT 126 >ref|XP_011097200.1| probable phosphopantothenoylcysteine decarboxylase isoform X2 [Sesamum indicum] Length = 240 Score = 215 bits (548), Expect = 7e-68 Identities = 106/128 (82%), Positives = 114/128 (89%) Frame = +1 Query: 124 KVMAHLEPANTDMNLYQVRNGPRKPRILLAASGSVAAMKFSNLCHCFSEWAEVKAVATKA 303 +VMAH EP T MNLYQ + RKPRILLAASGSVAA+KF+NLCHCFSEWAEVKAVATKA Sbjct: 29 QVMAHPEPP-TAMNLYQPNSATRKPRILLAASGSVAAIKFANLCHCFSEWAEVKAVATKA 87 Query: 304 SLHFVDIVSLPKDVILYTDEDEWSTWKKIGDSVLHIELRKWADIMVIAPLSANTLAKIAG 483 SLHF+D VS PKDV +YTDEDEWS WKKIGD+VLHIELR+WADIMVIAPLSANTL KIAG Sbjct: 88 SLHFIDRVSFPKDVTVYTDEDEWSMWKKIGDNVLHIELRRWADIMVIAPLSANTLGKIAG 147 Query: 484 GFCDNLLT 507 G CDNLLT Sbjct: 148 GLCDNLLT 155 >ref|XP_020547719.1| probable phosphopantothenoylcysteine decarboxylase isoform X1 [Sesamum indicum] Length = 259 Score = 215 bits (548), Expect = 1e-67 Identities = 106/128 (82%), Positives = 114/128 (89%) Frame = +1 Query: 124 KVMAHLEPANTDMNLYQVRNGPRKPRILLAASGSVAAMKFSNLCHCFSEWAEVKAVATKA 303 +VMAH EP T MNLYQ + RKPRILLAASGSVAA+KF+NLCHCFSEWAEVKAVATKA Sbjct: 48 QVMAHPEPP-TAMNLYQPNSATRKPRILLAASGSVAAIKFANLCHCFSEWAEVKAVATKA 106 Query: 304 SLHFVDIVSLPKDVILYTDEDEWSTWKKIGDSVLHIELRKWADIMVIAPLSANTLAKIAG 483 SLHF+D VS PKDV +YTDEDEWS WKKIGD+VLHIELR+WADIMVIAPLSANTL KIAG Sbjct: 107 SLHFIDRVSFPKDVTVYTDEDEWSMWKKIGDNVLHIELRRWADIMVIAPLSANTLGKIAG 166 Query: 484 GFCDNLLT 507 G CDNLLT Sbjct: 167 GLCDNLLT 174 >ref|XP_011097175.1| probable phosphopantothenoylcysteine decarboxylase isoform X3 [Sesamum indicum] ref|XP_011097183.1| probable phosphopantothenoylcysteine decarboxylase isoform X3 [Sesamum indicum] Length = 210 Score = 213 bits (543), Expect = 2e-67 Identities = 105/126 (83%), Positives = 112/126 (88%) Frame = +1 Query: 130 MAHLEPANTDMNLYQVRNGPRKPRILLAASGSVAAMKFSNLCHCFSEWAEVKAVATKASL 309 MAH EP T MNLYQ + RKPRILLAASGSVAA+KF+NLCHCFSEWAEVKAVATKASL Sbjct: 1 MAHPEPP-TAMNLYQPNSATRKPRILLAASGSVAAIKFANLCHCFSEWAEVKAVATKASL 59 Query: 310 HFVDIVSLPKDVILYTDEDEWSTWKKIGDSVLHIELRKWADIMVIAPLSANTLAKIAGGF 489 HF+D VS PKDV +YTDEDEWS WKKIGD+VLHIELR+WADIMVIAPLSANTL KIAGG Sbjct: 60 HFIDRVSFPKDVTVYTDEDEWSMWKKIGDNVLHIELRRWADIMVIAPLSANTLGKIAGGL 119 Query: 490 CDNLLT 507 CDNLLT Sbjct: 120 CDNLLT 125 >ref|XP_006476954.1| PREDICTED: phosphopantothenoylcysteine decarboxylase-like isoform X1 [Citrus sinensis] Length = 214 Score = 213 bits (542), Expect = 2e-67 Identities = 101/127 (79%), Positives = 111/127 (87%) Frame = +1 Query: 127 VMAHLEPANTDMNLYQVRNGPRKPRILLAASGSVAAMKFSNLCHCFSEWAEVKAVATKAS 306 +MA+ EP +TD QV G RKPRILLAASGSVAA+KF NLCHCFSEWAEV+AVATK+S Sbjct: 2 IMAYSEPTSTDREAMQVNTGLRKPRILLAASGSVAAIKFGNLCHCFSEWAEVRAVATKSS 61 Query: 307 LHFVDIVSLPKDVILYTDEDEWSTWKKIGDSVLHIELRKWADIMVIAPLSANTLAKIAGG 486 LHF+D +LPKDVI YTDEDEW+TW KIGDSVLHIELR+WADIMVIAPLSANTL KIAGG Sbjct: 62 LHFIDRAALPKDVIFYTDEDEWATWNKIGDSVLHIELRRWADIMVIAPLSANTLGKIAGG 121 Query: 487 FCDNLLT 507 CDNLLT Sbjct: 122 LCDNLLT 128 >ref|XP_006440019.1| phosphopantothenoylcysteine decarboxylase [Citrus clementina] ref|XP_006476955.1| PREDICTED: phosphopantothenoylcysteine decarboxylase-like isoform X2 [Citrus sinensis] ref|XP_006476956.1| PREDICTED: phosphopantothenoylcysteine decarboxylase-like isoform X2 [Citrus sinensis] ref|XP_024043604.1| phosphopantothenoylcysteine decarboxylase [Citrus clementina] gb|ESR53259.1| hypothetical protein CICLE_v10022229mg [Citrus clementina] gb|ESR53260.1| hypothetical protein CICLE_v10022229mg [Citrus clementina] Length = 212 Score = 212 bits (539), Expect = 7e-67 Identities = 101/126 (80%), Positives = 110/126 (87%) Frame = +1 Query: 130 MAHLEPANTDMNLYQVRNGPRKPRILLAASGSVAAMKFSNLCHCFSEWAEVKAVATKASL 309 MA+ EP +TD QV G RKPRILLAASGSVAA+KF NLCHCFSEWAEV+AVATK+SL Sbjct: 1 MAYSEPTSTDREAMQVNTGLRKPRILLAASGSVAAIKFGNLCHCFSEWAEVRAVATKSSL 60 Query: 310 HFVDIVSLPKDVILYTDEDEWSTWKKIGDSVLHIELRKWADIMVIAPLSANTLAKIAGGF 489 HF+D +LPKDVI YTDEDEW+TW KIGDSVLHIELR+WADIMVIAPLSANTL KIAGG Sbjct: 61 HFIDRAALPKDVIFYTDEDEWATWNKIGDSVLHIELRRWADIMVIAPLSANTLGKIAGGL 120 Query: 490 CDNLLT 507 CDNLLT Sbjct: 121 CDNLLT 126 >dbj|GAY50991.1| hypothetical protein CUMW_130870 [Citrus unshiu] Length = 286 Score = 213 bits (542), Expect = 2e-66 Identities = 101/127 (79%), Positives = 111/127 (87%) Frame = +1 Query: 127 VMAHLEPANTDMNLYQVRNGPRKPRILLAASGSVAAMKFSNLCHCFSEWAEVKAVATKAS 306 +MA+ EP +TD QV G RKPRILLAASGSVAA+KF NLCHCFSEWAEV+AVATK+S Sbjct: 74 IMAYSEPTSTDREAMQVNTGLRKPRILLAASGSVAAIKFGNLCHCFSEWAEVRAVATKSS 133 Query: 307 LHFVDIVSLPKDVILYTDEDEWSTWKKIGDSVLHIELRKWADIMVIAPLSANTLAKIAGG 486 LHF+D +LPKDVI YTDEDEW+TW KIGDSVLHIELR+WADIMVIAPLSANTL KIAGG Sbjct: 134 LHFIDRAALPKDVIFYTDEDEWATWNKIGDSVLHIELRRWADIMVIAPLSANTLGKIAGG 193 Query: 487 FCDNLLT 507 CDNLLT Sbjct: 194 LCDNLLT 200 >ref|XP_010036009.1| PREDICTED: probable phosphopantothenoylcysteine decarboxylase [Eucalyptus grandis] ref|XP_010036010.1| PREDICTED: probable phosphopantothenoylcysteine decarboxylase [Eucalyptus grandis] gb|KCW47531.1| hypothetical protein EUGRSUZ_K01291 [Eucalyptus grandis] Length = 211 Score = 210 bits (535), Expect = 3e-66 Identities = 100/126 (79%), Positives = 109/126 (86%) Frame = +1 Query: 130 MAHLEPANTDMNLYQVRNGPRKPRILLAASGSVAAMKFSNLCHCFSEWAEVKAVATKASL 309 MA E A T+ L PRKPRILLAASGSVAA+KF+NLCHCFSEWAEVKAVATKASL Sbjct: 1 MASAETAGTERGLLPTNGAPRKPRILLAASGSVAAIKFANLCHCFSEWAEVKAVATKASL 60 Query: 310 HFVDIVSLPKDVILYTDEDEWSTWKKIGDSVLHIELRKWADIMVIAPLSANTLAKIAGGF 489 HF+D SLP+DV+LYTDEDEWS+W KIGDSVLHIELR+WADIM+IAPLSANTL KIAGG Sbjct: 61 HFIDRASLPRDVVLYTDEDEWSSWSKIGDSVLHIELRRWADIMIIAPLSANTLGKIAGGL 120 Query: 490 CDNLLT 507 CDNLLT Sbjct: 121 CDNLLT 126 >ref|XP_012075726.1| probable phosphopantothenoylcysteine decarboxylase [Jatropha curcas] ref|XP_012075727.1| probable phosphopantothenoylcysteine decarboxylase [Jatropha curcas] gb|KDP35026.1| hypothetical protein JCGZ_09314 [Jatropha curcas] Length = 212 Score = 210 bits (535), Expect = 3e-66 Identities = 102/126 (80%), Positives = 110/126 (87%) Frame = +1 Query: 130 MAHLEPANTDMNLYQVRNGPRKPRILLAASGSVAAMKFSNLCHCFSEWAEVKAVATKASL 309 MA+ EPA T+ Q PRKPRILLAASGSVAA+KF NLCHCFSEWAEVKAVAT+ASL Sbjct: 1 MAYSEPATTEREPVQGTAVPRKPRILLAASGSVAAIKFGNLCHCFSEWAEVKAVATRASL 60 Query: 310 HFVDIVSLPKDVILYTDEDEWSTWKKIGDSVLHIELRKWADIMVIAPLSANTLAKIAGGF 489 HF+D SLPKDV+LYTDEDEWS+W KIGDSVLHIELR+WADIMVIAPLSANTL KIAGG Sbjct: 61 HFIDRASLPKDVVLYTDEDEWSSWNKIGDSVLHIELRRWADIMVIAPLSANTLGKIAGGL 120 Query: 490 CDNLLT 507 CDNLLT Sbjct: 121 CDNLLT 126 >ref|XP_019264197.1| PREDICTED: probable phosphopantothenoylcysteine decarboxylase [Nicotiana attenuata] ref|XP_019264198.1| PREDICTED: probable phosphopantothenoylcysteine decarboxylase [Nicotiana attenuata] gb|OIT36616.1| phosphopantothenoylcysteine decarboxylase [Nicotiana attenuata] Length = 209 Score = 209 bits (533), Expect = 5e-66 Identities = 98/123 (79%), Positives = 110/123 (89%) Frame = +1 Query: 139 LEPANTDMNLYQVRNGPRKPRILLAASGSVAAMKFSNLCHCFSEWAEVKAVATKASLHFV 318 +EP +++ QV N RKPRILLAASGSVA +KF+NLCHCFS+WAEVKAVATKASLHF+ Sbjct: 1 MEPITSEVEPIQVNNASRKPRILLAASGSVATIKFANLCHCFSKWAEVKAVATKASLHFI 60 Query: 319 DIVSLPKDVILYTDEDEWSTWKKIGDSVLHIELRKWADIMVIAPLSANTLAKIAGGFCDN 498 D VS PKDV+LYTD+DEWSTWKK+GDSVLHIELR+WADIMVIAPLSANTL KIAGG CDN Sbjct: 61 DKVSFPKDVVLYTDDDEWSTWKKVGDSVLHIELRRWADIMVIAPLSANTLGKIAGGLCDN 120 Query: 499 LLT 507 LLT Sbjct: 121 LLT 123 >ref|XP_002526282.1| PREDICTED: phosphopantothenoylcysteine decarboxylase [Ricinus communis] ref|XP_015579109.1| PREDICTED: phosphopantothenoylcysteine decarboxylase [Ricinus communis] gb|EEF36071.1| phosphopentothenoylcysteine decarboxylase, putative [Ricinus communis] Length = 212 Score = 209 bits (533), Expect = 5e-66 Identities = 101/126 (80%), Positives = 109/126 (86%) Frame = +1 Query: 130 MAHLEPANTDMNLYQVRNGPRKPRILLAASGSVAAMKFSNLCHCFSEWAEVKAVATKASL 309 MA+ E A + QV PRKPRILLAASGSVAA+KF NLCHCFSEWAEV+AVATKASL Sbjct: 1 MAYSESATAEREPMQVNASPRKPRILLAASGSVAAIKFGNLCHCFSEWAEVRAVATKASL 60 Query: 310 HFVDIVSLPKDVILYTDEDEWSTWKKIGDSVLHIELRKWADIMVIAPLSANTLAKIAGGF 489 HF+D SLPKDV+LYTDEDEWS+W KIGDSVLHIELR+WADIMVIAPLSANTL KIAGG Sbjct: 61 HFIDRASLPKDVVLYTDEDEWSSWNKIGDSVLHIELRRWADIMVIAPLSANTLGKIAGGL 120 Query: 490 CDNLLT 507 CDNLLT Sbjct: 121 CDNLLT 126 >ref|XP_016752257.1| PREDICTED: phosphopantothenoylcysteine decarboxylase-like [Gossypium hirsutum] ref|XP_016752258.1| PREDICTED: phosphopantothenoylcysteine decarboxylase-like [Gossypium hirsutum] ref|XP_017643816.1| PREDICTED: phosphopantothenoylcysteine decarboxylase-like [Gossypium arboreum] ref|XP_017643817.1| PREDICTED: phosphopantothenoylcysteine decarboxylase-like [Gossypium arboreum] ref|XP_017643818.1| PREDICTED: phosphopantothenoylcysteine decarboxylase-like [Gossypium arboreum] gb|KHG00807.1| Phosphopantothenoylcysteine decarboxylase -like protein [Gossypium arboreum] Length = 208 Score = 209 bits (532), Expect = 7e-66 Identities = 100/126 (79%), Positives = 110/126 (87%) Frame = +1 Query: 130 MAHLEPANTDMNLYQVRNGPRKPRILLAASGSVAAMKFSNLCHCFSEWAEVKAVATKASL 309 MA+ EP D + +V PRKPR+LLAASGSVAA+KF NLCHCFSEWAEVKAVATKASL Sbjct: 1 MAYPEPQGADREMVKVNPTPRKPRVLLAASGSVAAIKFGNLCHCFSEWAEVKAVATKASL 60 Query: 310 HFVDIVSLPKDVILYTDEDEWSTWKKIGDSVLHIELRKWADIMVIAPLSANTLAKIAGGF 489 HF+DI SLPKD+ LYTDE+EWS+W KIGDSVLHIELR+WADIMVIAPLSANTL KIAGG Sbjct: 61 HFIDIASLPKDLKLYTDEEEWSSWGKIGDSVLHIELRRWADIMVIAPLSANTLGKIAGGL 120 Query: 490 CDNLLT 507 CDNLLT Sbjct: 121 CDNLLT 126 >ref|XP_022772747.1| phosphopantothenoylcysteine decarboxylase-like [Durio zibethinus] Length = 212 Score = 209 bits (531), Expect = 1e-65 Identities = 100/126 (79%), Positives = 110/126 (87%) Frame = +1 Query: 130 MAHLEPANTDMNLYQVRNGPRKPRILLAASGSVAAMKFSNLCHCFSEWAEVKAVATKASL 309 MA+ EP N + + QV PRKPRILLAASGSVAA+KF NLCHCFSEWAEVKAVATKASL Sbjct: 1 MAYPEPQNAEREIVQVNTTPRKPRILLAASGSVAAIKFGNLCHCFSEWAEVKAVATKASL 60 Query: 310 HFVDIVSLPKDVILYTDEDEWSTWKKIGDSVLHIELRKWADIMVIAPLSANTLAKIAGGF 489 HF+D SLPKDV LYTDE+EWS+W KIGD+VLHIELR+WADIMVI+PLSANTL KIAGG Sbjct: 61 HFIDRASLPKDVNLYTDEEEWSSWGKIGDNVLHIELRRWADIMVISPLSANTLGKIAGGL 120 Query: 490 CDNLLT 507 CDNLLT Sbjct: 121 CDNLLT 126 >ref|XP_021678000.1| probable phosphopantothenoylcysteine decarboxylase isoform X2 [Hevea brasiliensis] ref|XP_021678001.1| probable phosphopantothenoylcysteine decarboxylase isoform X2 [Hevea brasiliensis] ref|XP_021678002.1| probable phosphopantothenoylcysteine decarboxylase isoform X2 [Hevea brasiliensis] ref|XP_021678003.1| probable phosphopantothenoylcysteine decarboxylase isoform X2 [Hevea brasiliensis] Length = 212 Score = 208 bits (529), Expect = 2e-65 Identities = 99/126 (78%), Positives = 109/126 (86%) Frame = +1 Query: 130 MAHLEPANTDMNLYQVRNGPRKPRILLAASGSVAAMKFSNLCHCFSEWAEVKAVATKASL 309 MA +PA T L QV + PRKPRILL ASGSVAA+KF NLCHCFS+WAEV+AVAT+ASL Sbjct: 1 MACSDPATTQRELVQVTSAPRKPRILLGASGSVAAIKFGNLCHCFSDWAEVRAVATRASL 60 Query: 310 HFVDIVSLPKDVILYTDEDEWSTWKKIGDSVLHIELRKWADIMVIAPLSANTLAKIAGGF 489 HF+D SLPKDV+LYTDEDEW +W KIGDSVLHIELR+WADIMVIAPLSANTL KIAGG Sbjct: 61 HFIDRASLPKDVVLYTDEDEWYSWNKIGDSVLHIELRRWADIMVIAPLSANTLGKIAGGL 120 Query: 490 CDNLLT 507 CDNLLT Sbjct: 121 CDNLLT 126 >ref|XP_016488075.1| PREDICTED: probable phosphopantothenoylcysteine decarboxylase [Nicotiana tabacum] ref|XP_016488076.1| PREDICTED: probable phosphopantothenoylcysteine decarboxylase [Nicotiana tabacum] Length = 209 Score = 207 bits (528), Expect = 3e-65 Identities = 97/123 (78%), Positives = 110/123 (89%) Frame = +1 Query: 139 LEPANTDMNLYQVRNGPRKPRILLAASGSVAAMKFSNLCHCFSEWAEVKAVATKASLHFV 318 +EP +++ QV N RKPRILLAASGSVA +KF+NLCHCFS+WAEVKAVATKASLHF+ Sbjct: 1 MEPITSEVEPIQVNNASRKPRILLAASGSVATIKFANLCHCFSKWAEVKAVATKASLHFI 60 Query: 319 DIVSLPKDVILYTDEDEWSTWKKIGDSVLHIELRKWADIMVIAPLSANTLAKIAGGFCDN 498 D VS PKDV+LYTD+DEWSTWKK+GDSVLHIELR+WADIMVIAPLSANTL KIAGG C+N Sbjct: 61 DKVSFPKDVVLYTDDDEWSTWKKVGDSVLHIELRRWADIMVIAPLSANTLGKIAGGLCNN 120 Query: 499 LLT 507 LLT Sbjct: 121 LLT 123