BLASTX nr result
ID: Rehmannia30_contig00022963
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00022963 (469 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011089270.1| receptor-like serine/threonine-protein kinas... 69 1e-10 ref|XP_011089265.1| receptor-like serine/threonine-protein kinas... 69 1e-10 gb|PIN07658.1| Serine/threonine protein kinase [Handroanthus imp... 68 3e-10 gb|EYU18813.1| hypothetical protein MIMGU_mgv1a002723mg [Erythra... 66 2e-09 ref|XP_012827893.1| PREDICTED: receptor-like serine/threonine-pr... 66 2e-09 gb|KZV39759.1| receptor-like serine/threonine-protein kinase NCR... 65 4e-09 >ref|XP_011089270.1| receptor-like serine/threonine-protein kinase NCRK isoform X2 [Sesamum indicum] Length = 594 Score = 68.9 bits (167), Expect = 1e-10 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +1 Query: 1 RSWRLQDDEVVDLTEPRFESFCLPNVDSHIVKIT 102 RSWRLQDDEVVD+TEPRFESFCLPNVDS I KIT Sbjct: 561 RSWRLQDDEVVDITEPRFESFCLPNVDSRIFKIT 594 >ref|XP_011089265.1| receptor-like serine/threonine-protein kinase NCRK isoform X1 [Sesamum indicum] ref|XP_011089266.1| receptor-like serine/threonine-protein kinase NCRK isoform X1 [Sesamum indicum] ref|XP_011089267.1| receptor-like serine/threonine-protein kinase NCRK isoform X1 [Sesamum indicum] ref|XP_011089269.1| receptor-like serine/threonine-protein kinase NCRK isoform X1 [Sesamum indicum] ref|XP_020552612.1| receptor-like serine/threonine-protein kinase NCRK isoform X1 [Sesamum indicum] ref|XP_020552613.1| receptor-like serine/threonine-protein kinase NCRK isoform X1 [Sesamum indicum] ref|XP_020552614.1| receptor-like serine/threonine-protein kinase NCRK isoform X1 [Sesamum indicum] Length = 630 Score = 68.9 bits (167), Expect = 1e-10 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +1 Query: 1 RSWRLQDDEVVDLTEPRFESFCLPNVDSHIVKIT 102 RSWRLQDDEVVD+TEPRFESFCLPNVDS I KIT Sbjct: 597 RSWRLQDDEVVDITEPRFESFCLPNVDSRIFKIT 630 >gb|PIN07658.1| Serine/threonine protein kinase [Handroanthus impetiginosus] Length = 621 Score = 67.8 bits (164), Expect = 3e-10 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +1 Query: 1 RSWRLQDDEVVDLTEPRFESFCLPNVDSHIVKIT 102 RSWR QDDE VD+TEPRFESFCL NVDSHIVKIT Sbjct: 587 RSWRFQDDETVDITEPRFESFCLSNVDSHIVKIT 620 >gb|EYU18813.1| hypothetical protein MIMGU_mgv1a002723mg [Erythranthe guttata] Length = 642 Score = 65.9 bits (159), Expect = 2e-09 Identities = 31/35 (88%), Positives = 34/35 (97%), Gaps = 1/35 (2%) Frame = +1 Query: 1 RSWRLQDDEV-VDLTEPRFESFCLPNVDSHIVKIT 102 RSWRL+DD+V VDLTEPRFESFCLPNVDSHIV+IT Sbjct: 608 RSWRLRDDDVAVDLTEPRFESFCLPNVDSHIVEIT 642 >ref|XP_012827893.1| PREDICTED: receptor-like serine/threonine-protein kinase NCRK [Erythranthe guttata] gb|EYU18812.1| hypothetical protein MIMGU_mgv1a002723mg [Erythranthe guttata] Length = 643 Score = 65.9 bits (159), Expect = 2e-09 Identities = 31/35 (88%), Positives = 34/35 (97%), Gaps = 1/35 (2%) Frame = +1 Query: 1 RSWRLQDDEV-VDLTEPRFESFCLPNVDSHIVKIT 102 RSWRL+DD+V VDLTEPRFESFCLPNVDSHIV+IT Sbjct: 609 RSWRLRDDDVAVDLTEPRFESFCLPNVDSHIVEIT 643 >gb|KZV39759.1| receptor-like serine/threonine-protein kinase NCRK [Dorcoceras hygrometricum] Length = 803 Score = 64.7 bits (156), Expect = 4e-09 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 1 RSWRLQDDEVVDLTEPRFESFCLPNVDSHIVKI 99 RSWRLQDDEVVDLTEPR ESFCLP+ DSH +KI Sbjct: 770 RSWRLQDDEVVDLTEPRLESFCLPSADSHTIKI 802