BLASTX nr result
ID: Rehmannia30_contig00022650
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00022650 (738 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022152767.1| mediator of RNA polymerase II transcription ... 73 4e-13 ref|XP_016903173.1| PREDICTED: mediator of RNA polymerase II tra... 73 4e-13 dbj|BAT82259.1| hypothetical protein VIGAN_03224200 [Vigna angul... 71 2e-12 gb|PKI50746.1| hypothetical protein CRG98_028888 [Punica granatum] 72 2e-12 emb|CAN78338.1| hypothetical protein VITISV_004622 [Vitis vinifera] 72 2e-12 gb|KDO52723.1| hypothetical protein CISIN_1g0219112mg, partial [... 70 4e-12 gb|KZM98124.1| hypothetical protein DCAR_014514 [Daucus carota s... 70 4e-12 dbj|BAF10467.1| Os02g0821800, partial [Oryza sativa Japonica Group] 70 5e-12 gb|AGM38071.1| putative fibrillarin, partial [Stenocereus gummosus] 72 5e-12 gb|EOY23275.1| RRNA 2'-O-methyltransferase fibrillarin 2 [Theobr... 70 1e-11 dbj|BAF95852.1| putative fibrillarin, partial [Vitis hybrid cult... 72 1e-11 gb|PPS20450.1| hypothetical protein GOBAR_AA00134 [Gossypium bar... 72 2e-11 emb|CBI22679.3| unnamed protein product, partial [Vitis vinifera] 72 2e-11 gb|PPD72919.1| hypothetical protein GOBAR_DD30188 [Gossypium bar... 72 2e-11 gb|EEF49070.1| fibrillarin, putative [Ricinus communis] 72 2e-11 gb|OMO91073.1| Fibrillarin [Corchorus capsularis] 72 3e-11 gb|PHT53276.1| putative mediator of RNA polymerase II transcript... 68 3e-11 gb|PIN20281.1| Fibrillarin [Handroanthus impetiginosus] 72 3e-11 gb|OAY30349.1| hypothetical protein MANES_14G023700 [Manihot esc... 72 3e-11 gb|PPD97074.1| hypothetical protein GOBAR_DD05862 [Gossypium bar... 72 3e-11 >ref|XP_022152767.1| mediator of RNA polymerase II transcription subunit 36a-like [Momordica charantia] Length = 83 Score = 72.8 bits (177), Expect = 4e-13 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +1 Query: 631 LQARILALNASYFLKAGGHFVISIKANCIDSTVPAE 738 +QARILALNASYFLKAGGHFVISIKANCIDSTVPAE Sbjct: 1 MQARILALNASYFLKAGGHFVISIKANCIDSTVPAE 36 >ref|XP_016903173.1| PREDICTED: mediator of RNA polymerase II transcription subunit 36a-like [Cucumis melo] Length = 83 Score = 72.8 bits (177), Expect = 4e-13 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +1 Query: 631 LQARILALNASYFLKAGGHFVISIKANCIDSTVPAE 738 +QARILALNASYFLKAGGHFVISIKANCIDSTVPAE Sbjct: 1 MQARILALNASYFLKAGGHFVISIKANCIDSTVPAE 36 >dbj|BAT82259.1| hypothetical protein VIGAN_03224200 [Vigna angularis var. angularis] Length = 90 Score = 71.2 bits (173), Expect = 2e-12 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = +1 Query: 619 FVFFLQARILALNASYFLKAGGHFVISIKANCIDSTVPAE 738 F LQARIL LNASY+LKAGGHFVISIKANCIDSTVPAE Sbjct: 3 FFLPLQARILGLNASYYLKAGGHFVISIKANCIDSTVPAE 42 >gb|PKI50746.1| hypothetical protein CRG98_028888 [Punica granatum] Length = 121 Score = 72.0 bits (175), Expect = 2e-12 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 634 QARILALNASYFLKAGGHFVISIKANCIDSTVPAE 738 QARILALNASYFLKAGGHFVISIKANCIDSTVPAE Sbjct: 40 QARILALNASYFLKAGGHFVISIKANCIDSTVPAE 74 >emb|CAN78338.1| hypothetical protein VITISV_004622 [Vitis vinifera] Length = 121 Score = 72.0 bits (175), Expect = 2e-12 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 634 QARILALNASYFLKAGGHFVISIKANCIDSTVPAE 738 QARILALNASYFLKAGGHFVISIKANCIDSTVPAE Sbjct: 40 QARILALNASYFLKAGGHFVISIKANCIDSTVPAE 74 >gb|KDO52723.1| hypothetical protein CISIN_1g0219112mg, partial [Citrus sinensis] Length = 79 Score = 70.1 bits (170), Expect = 4e-12 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 637 ARILALNASYFLKAGGHFVISIKANCIDSTVPAE 738 ARILALNASYFLKAGGHFVISIKANCIDSTVPAE Sbjct: 1 ARILALNASYFLKAGGHFVISIKANCIDSTVPAE 34 >gb|KZM98124.1| hypothetical protein DCAR_014514 [Daucus carota subsp. sativus] Length = 84 Score = 70.1 bits (170), Expect = 4e-12 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 637 ARILALNASYFLKAGGHFVISIKANCIDSTVPAE 738 ARILALNASYFLKAGGHFVISIKANCIDSTVPAE Sbjct: 2 ARILALNASYFLKAGGHFVISIKANCIDSTVPAE 35 >dbj|BAF10467.1| Os02g0821800, partial [Oryza sativa Japonica Group] Length = 87 Score = 70.1 bits (170), Expect = 5e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +1 Query: 631 LQARILALNASYFLKAGGHFVISIKANCIDSTVPAE 738 LQARILALNASYFLK GGHFVISIKANCIDST+PAE Sbjct: 5 LQARILALNASYFLKNGGHFVISIKANCIDSTMPAE 40 >gb|AGM38071.1| putative fibrillarin, partial [Stenocereus gummosus] Length = 157 Score = 72.0 bits (175), Expect = 5e-12 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 634 QARILALNASYFLKAGGHFVISIKANCIDSTVPAE 738 QARILALNASYFLKAGGHFVISIKANCIDSTVPAE Sbjct: 75 QARILALNASYFLKAGGHFVISIKANCIDSTVPAE 109 >gb|EOY23275.1| RRNA 2'-O-methyltransferase fibrillarin 2 [Theobroma cacao] Length = 133 Score = 70.5 bits (171), Expect = 1e-11 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = +1 Query: 619 FVFFLQARILALNASYFLKAGGHFVISIKANCIDSTVPAE 738 F + ARILALNASYFLKAGGHFVISIKANCIDSTVPAE Sbjct: 47 FSYPYPARILALNASYFLKAGGHFVISIKANCIDSTVPAE 86 >dbj|BAF95852.1| putative fibrillarin, partial [Vitis hybrid cultivar] Length = 204 Score = 72.0 bits (175), Expect = 1e-11 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 634 QARILALNASYFLKAGGHFVISIKANCIDSTVPAE 738 QARILALNASYFLKAGGHFVISIKANCIDSTVPAE Sbjct: 123 QARILALNASYFLKAGGHFVISIKANCIDSTVPAE 157 >gb|PPS20450.1| hypothetical protein GOBAR_AA00134 [Gossypium barbadense] Length = 245 Score = 72.0 bits (175), Expect = 2e-11 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 634 QARILALNASYFLKAGGHFVISIKANCIDSTVPAE 738 QARILALNASYFLKAGGHFVISIKANCIDSTVPAE Sbjct: 164 QARILALNASYFLKAGGHFVISIKANCIDSTVPAE 198 >emb|CBI22679.3| unnamed protein product, partial [Vitis vinifera] Length = 245 Score = 72.0 bits (175), Expect = 2e-11 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 634 QARILALNASYFLKAGGHFVISIKANCIDSTVPAE 738 QARILALNASYFLKAGGHFVISIKANCIDSTVPAE Sbjct: 164 QARILALNASYFLKAGGHFVISIKANCIDSTVPAE 198 >gb|PPD72919.1| hypothetical protein GOBAR_DD30188 [Gossypium barbadense] Length = 246 Score = 72.0 bits (175), Expect = 2e-11 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 634 QARILALNASYFLKAGGHFVISIKANCIDSTVPAE 738 QARILALNASYFLKAGGHFVISIKANCIDSTVPAE Sbjct: 164 QARILALNASYFLKAGGHFVISIKANCIDSTVPAE 198 >gb|EEF49070.1| fibrillarin, putative [Ricinus communis] Length = 247 Score = 72.0 bits (175), Expect = 2e-11 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 634 QARILALNASYFLKAGGHFVISIKANCIDSTVPAE 738 QARILALNASYFLKAGGHFVISIKANCIDSTVPAE Sbjct: 165 QARILALNASYFLKAGGHFVISIKANCIDSTVPAE 199 >gb|OMO91073.1| Fibrillarin [Corchorus capsularis] Length = 249 Score = 72.0 bits (175), Expect = 3e-11 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 634 QARILALNASYFLKAGGHFVISIKANCIDSTVPAE 738 QARILALNASYFLKAGGHFVISIKANCIDSTVPAE Sbjct: 170 QARILALNASYFLKAGGHFVISIKANCIDSTVPAE 204 >gb|PHT53276.1| putative mediator of RNA polymerase II transcription subunit 36b [Capsicum baccatum] Length = 90 Score = 68.2 bits (165), Expect = 3e-11 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +1 Query: 628 FLQARILALNASYFLKAGGHFVISIKANCIDSTVPAE 738 + QARILALNASYFLKAGGHFVISIKAN IDSTVPAE Sbjct: 7 YSQARILALNASYFLKAGGHFVISIKANYIDSTVPAE 43 >gb|PIN20281.1| Fibrillarin [Handroanthus impetiginosus] Length = 265 Score = 72.0 bits (175), Expect = 3e-11 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 634 QARILALNASYFLKAGGHFVISIKANCIDSTVPAE 738 QARILALNASYFLKAGGHFVISIKANCIDSTVPAE Sbjct: 184 QARILALNASYFLKAGGHFVISIKANCIDSTVPAE 218 >gb|OAY30349.1| hypothetical protein MANES_14G023700 [Manihot esculenta] Length = 269 Score = 72.0 bits (175), Expect = 3e-11 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 634 QARILALNASYFLKAGGHFVISIKANCIDSTVPAE 738 QARILALNASYFLKAGGHFVISIKANCIDSTVPAE Sbjct: 188 QARILALNASYFLKAGGHFVISIKANCIDSTVPAE 222 >gb|PPD97074.1| hypothetical protein GOBAR_DD05862 [Gossypium barbadense] Length = 270 Score = 72.0 bits (175), Expect = 3e-11 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = +1 Query: 634 QARILALNASYFLKAGGHFVISIKANCIDSTVPAE 738 QARILALNASYFLKAGGHFVISIKANCIDSTVPAE Sbjct: 189 QARILALNASYFLKAGGHFVISIKANCIDSTVPAE 223