BLASTX nr result
ID: Rehmannia30_contig00022408
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00022408 (527 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN01405.1| WD40 repeat protein [Handroanthus impetiginosus] 58 1e-06 ref|XP_011089371.1| DDB1- and CUL4-associated factor 8 [Sesamum ... 56 5e-06 ref|XP_012827795.1| PREDICTED: DDB1- and CUL4-associated factor ... 56 5e-06 ref|XP_022893107.1| DDB1- and CUL4-associated factor 8 [Olea eur... 56 7e-06 >gb|PIN01405.1| WD40 repeat protein [Handroanthus impetiginosus] Length = 476 Score = 57.8 bits (138), Expect = 1e-06 Identities = 30/52 (57%), Positives = 33/52 (63%) Frame = +3 Query: 6 KKLSKHEGSVHSPTVEPRSPYVFHSCGEDDIVQHRVLHWYSLKKEVAVGLNS 161 KKLSKH+G VH VEP SPYVF+SCGED VQH Y L+ A L S Sbjct: 135 KKLSKHQGRVHRLAVEPGSPYVFYSCGEDGFVQH-----YDLRSNSATKLFS 181 >ref|XP_011089371.1| DDB1- and CUL4-associated factor 8 [Sesamum indicum] ref|XP_020552513.1| DDB1- and CUL4-associated factor 8 [Sesamum indicum] Length = 477 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/44 (61%), Positives = 30/44 (68%) Frame = +3 Query: 6 KKLSKHEGSVHSPTVEPRSPYVFHSCGEDDIVQHRVLHWYSLKK 137 K+LSKH+G VH VEP SPYVF+SCGED VQH L S K Sbjct: 135 KRLSKHQGRVHRLAVEPGSPYVFYSCGEDGFVQHYDLRSNSATK 178 >ref|XP_012827795.1| PREDICTED: DDB1- and CUL4-associated factor 8 [Erythranthe guttata] gb|EYU18885.1| hypothetical protein MIMGU_mgv1a005546mg [Erythranthe guttata] Length = 479 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/44 (61%), Positives = 30/44 (68%) Frame = +3 Query: 6 KKLSKHEGSVHSPTVEPRSPYVFHSCGEDDIVQHRVLHWYSLKK 137 K+LSKH+G VH VEP SPYVF+SCGED VQH L S K Sbjct: 135 KRLSKHQGRVHRLAVEPGSPYVFYSCGEDGFVQHYDLRSNSATK 178 >ref|XP_022893107.1| DDB1- and CUL4-associated factor 8 [Olea europaea var. sylvestris] Length = 477 Score = 55.8 bits (133), Expect = 7e-06 Identities = 26/50 (52%), Positives = 34/50 (68%) Frame = +3 Query: 6 KKLSKHEGSVHSPTVEPRSPYVFHSCGEDDIVQHRVLHWYSLKKEVAVGL 155 K+L+KH+G VH+ VEP SPY+F+SCGED VQH Y L+ + A L Sbjct: 135 KRLAKHQGRVHNLAVEPGSPYIFYSCGEDGFVQH-----YDLRSKSATKL 179