BLASTX nr result
ID: Rehmannia30_contig00022290
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00022290 (513 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001238509.1| histone H3.2 [Glycine max] >gi|1023300851|re... 261 1e-87 gb|KYP58465.1| Histone H3.2, partial [Cajanus cajan] 261 1e-87 ref|XP_020195127.1| histone H3.2-like [Aegilops tauschii subsp. ... 261 3e-87 ref|XP_020168912.1| histone H3.2-like [Aegilops tauschii subsp. ... 260 4e-87 ref|XP_019199849.1| PREDICTED: histone H3.2-like [Ipomoea nil] 260 4e-87 ref|NP_189372.1| Histone superfamily protein [Arabidopsis thalia... 260 4e-87 emb|CBH32561.1| histone H3, expressed [Triticum aestivum] >gi|32... 260 4e-87 gb|PIA53463.1| hypothetical protein AQUCO_00900211v1, partial [A... 260 4e-87 ref|XP_017621393.1| PREDICTED: histone H3.2-like [Gossypium arbo... 260 5e-87 gb|AAA32655.1| histone H3 (H3-1.1) [Medicago sativa] 260 5e-87 ref|XP_010260926.1| PREDICTED: histone H3.2-like [Nelumbo nucifera] 260 5e-87 emb|CDP18134.1| unnamed protein product [Coffea canephora] 260 5e-87 ref|XP_012081631.1| histone H3.2 [Jatropha curcas] >gi|643718543... 259 7e-87 ref|XP_013631332.1| PREDICTED: histone H3.2-like [Brassica olera... 260 8e-87 gb|KCW51227.1| hypothetical protein EUGRSUZ_J00806, partial [Euc... 260 8e-87 ref|XP_009393405.2| PREDICTED: histone H3.2 [Musa acuminata subs... 260 9e-87 gb|PIA53454.1| hypothetical protein AQUCO_00900205v1, partial [A... 260 9e-87 gb|KQL29950.1| hypothetical protein SETIT_019787mg, partial [Set... 260 9e-87 ref|XP_016690064.1| PREDICTED: histone H3.2-like [Gossypium hirs... 260 1e-86 prf||1202289A histone H3 259 1e-86 >ref|NP_001238509.1| histone H3.2 [Glycine max] ref|NP_001311089.1| uncharacterized protein LOC107648867 [Zea mays] ref|XP_003529355.1| PREDICTED: histone H3.2 [Glycine max] ref|XP_003531787.1| PREDICTED: histone H3.2 [Glycine max] ref|XP_003531853.1| PREDICTED: histone H3.2 [Glycine max] ref|XP_003537953.1| PREDICTED: histone H3.2 [Glycine max] ref|XP_003539404.1| PREDICTED: histone H3.2 [Glycine max] ref|XP_003542714.1| PREDICTED: histone H3.2 [Glycine max] ref|XP_003546675.1| PREDICTED: histone H3.2 [Glycine max] ref|XP_003557185.1| PREDICTED: histone H3.2 [Brachypodium distachyon] ref|XP_003564281.1| PREDICTED: histone H3.2 [Brachypodium distachyon] ref|XP_003568367.1| PREDICTED: histone H3.2 [Brachypodium distachyon] ref|XP_003575094.1| PREDICTED: histone H3.2 [Brachypodium distachyon] ref|XP_003612856.1| core histone H2A/H2B/H3/H4 [Medicago truncatula] ref|XP_003622981.1| core histone H2A/H2B/H3/H4 [Medicago truncatula] ref|XP_003628691.1| core histone H2A/H2B/H3/H4 [Medicago truncatula] ref|XP_003630185.1| core histone H2A/H2B/H3/H4 [Medicago truncatula] ref|XP_004140867.1| PREDICTED: histone H3.2 [Cucumis sativus] ref|XP_004488709.1| PREDICTED: histone H3.2 [Cicer arietinum] ref|XP_004489510.1| PREDICTED: histone H3.2 [Cicer arietinum] ref|XP_004489511.1| PREDICTED: histone H3.2 [Cicer arietinum] ref|XP_004489512.1| PREDICTED: histone H3.2 [Cicer arietinum] ref|XP_004489513.1| PREDICTED: histone H3.2 [Cicer arietinum] ref|XP_004503973.1| PREDICTED: histone H3.2 [Cicer arietinum] ref|XP_004505111.1| PREDICTED: histone H3.2 [Cicer arietinum] ref|XP_004512510.1| PREDICTED: histone H3.2 [Cicer arietinum] ref|XP_006383727.1| hypothetical protein POPTR_0005s25530g [Populus trichocarpa] ref|XP_006595049.1| PREDICTED: histone H3.2 [Glycine max] ref|XP_006597243.1| PREDICTED: histone H3.2 [Glycine max] ref|XP_007131986.1| hypothetical protein PHAVU_011G057200g [Phaseolus vulgaris] ref|XP_007133533.1| hypothetical protein PHAVU_011G187100g [Phaseolus vulgaris] ref|XP_007139488.1| hypothetical protein PHAVU_008G033700g [Phaseolus vulgaris] ref|XP_007153894.1| hypothetical protein PHAVU_003G073800g [Phaseolus vulgaris] ref|XP_007159809.1| hypothetical protein PHAVU_002G269200g [Phaseolus vulgaris] ref|XP_007159810.1| hypothetical protein PHAVU_002G269300g [Phaseolus vulgaris] ref|XP_008352444.1| PREDICTED: histone H3.2 [Malus domestica] ref|XP_008384522.1| PREDICTED: histone H3.2 [Malus domestica] ref|XP_008384524.1| PREDICTED: histone H3.2 [Malus domestica] ref|XP_008445689.1| PREDICTED: histone H3.2 [Cucumis melo] ref|XP_008657023.1| histone H3.2 [Zea mays] ref|XP_008784458.1| PREDICTED: histone H3.2 [Phoenix dactylifera] ref|XP_008785823.1| PREDICTED: histone H3.2 [Phoenix dactylifera] ref|XP_009374750.1| PREDICTED: histone H3.2 [Pyrus x bretschneideri] ref|XP_009379418.1| PREDICTED: histone H3.2 [Pyrus x bretschneideri] ref|XP_009379421.1| PREDICTED: histone H3.2 [Pyrus x bretschneideri] ref|XP_009414586.1| PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis] ref|XP_010025543.1| PREDICTED: histone H3.2 [Eucalyptus grandis] ref|XP_010025545.1| PREDICTED: histone H3.2 [Eucalyptus grandis] ref|XP_010246200.1| PREDICTED: histone H3.2 [Nelumbo nucifera] ref|XP_010231094.1| PREDICTED: histone H3.2 [Brachypodium distachyon] ref|XP_010231492.1| PREDICTED: histone H3.2 [Brachypodium distachyon] ref|XP_010237279.1| PREDICTED: histone H3.2 [Brachypodium distachyon] ref|XP_010523315.1| PREDICTED: histone H3.2 [Tarenaya hassleriana] ref|XP_010928463.1| PREDICTED: histone H3.2 [Elaeis guineensis] ref|XP_011045162.1| PREDICTED: histone H3.2 [Populus euphratica] ref|XP_011014732.1| PREDICTED: histone H3.2 [Populus euphratica] ref|XP_003630195.2| core histone H2A/H2B/H3/H4 [Medicago truncatula] ref|XP_013447325.1| core histone H2A/H2B/H3/H4 [Medicago truncatula] ref|XP_003612851.2| core histone H2A/H2B/H3/H4 [Medicago truncatula] ref|XP_013456228.1| core histone H2A/H2B/H3/H4 [Medicago truncatula] ref|XP_013456925.1| core histone H2A/H2B/H3/H4 [Medicago truncatula] ref|XP_003594840.2| core histone H2A/H2B/H3/H4 [Medicago truncatula] ref|XP_014494055.1| histone H3.2 [Vigna radiata var. radiata] ref|XP_014497676.1| histone H3.2 [Vigna radiata var. radiata] ref|XP_014492217.1| histone H3.2 [Vigna radiata var. radiata] ref|XP_015952173.1| histone H3.2 [Arachis duranensis] ref|XP_015935473.1| histone H3.2 [Arachis duranensis] ref|XP_015945894.1| histone H3.2 [Arachis duranensis] ref|XP_016187161.1| histone H3.2 [Arachis ipaensis] ref|XP_016171059.1| histone H3.2 [Arachis ipaensis] ref|XP_017409105.1| PREDICTED: histone H3.2 [Vigna angularis] ref|XP_017410882.1| PREDICTED: histone H3.2 [Vigna angularis] ref|XP_017436757.1| PREDICTED: histone H3.2 [Vigna angularis] ref|XP_017436770.1| PREDICTED: histone H3.2 [Vigna angularis] ref|XP_017425736.1| PREDICTED: histone H3.2 [Vigna angularis] ref|XP_017433240.1| PREDICTED: histone H3.2 [Vigna angularis] ref|XP_018851509.1| PREDICTED: histone H3.2 [Juglans regia] ref|XP_018830869.1| PREDICTED: histone H3.2 [Juglans regia] ref|XP_019434508.1| PREDICTED: histone H3.2 [Lupinus angustifolius] ref|XP_019462708.1| PREDICTED: histone H3.2 [Lupinus angustifolius] ref|XP_019457693.1| PREDICTED: histone H3.2 [Lupinus angustifolius] ref|XP_019457694.1| PREDICTED: histone H3.2 [Lupinus angustifolius] ref|XP_019463783.1| PREDICTED: histone H3.2 [Lupinus angustifolius] ref|XP_019417246.1| PREDICTED: histone H3.2 [Lupinus angustifolius] ref|XP_019417898.1| PREDICTED: histone H3.2 [Lupinus angustifolius] ref|XP_019424439.1| PREDICTED: histone H3.2 [Lupinus angustifolius] ref|XP_019437230.1| PREDICTED: histone H3.2 [Lupinus angustifolius] ref|XP_019445693.1| PREDICTED: histone H3.2 [Lupinus angustifolius] ref|XP_019448294.1| PREDICTED: histone H3.2 [Lupinus angustifolius] ref|XP_020156190.1| histone H3.2 [Aegilops tauschii subsp. tauschii] ref|XP_020176712.1| histone H3.2 [Aegilops tauschii subsp. tauschii] ref|XP_020180106.1| histone H3.2 [Aegilops tauschii subsp. tauschii] ref|XP_020180107.1| histone H3.2 [Aegilops tauschii subsp. tauschii] ref|XP_020180705.1| histone H3.2 [Aegilops tauschii subsp. tauschii] ref|XP_020181396.1| histone H3.2 [Aegilops tauschii subsp. tauschii] ref|XP_020183600.1| histone H3.2 [Aegilops tauschii subsp. tauschii] ref|XP_020183994.1| histone H3.2 [Aegilops tauschii subsp. tauschii] ref|XP_020195754.1| histone H3.2 [Aegilops tauschii subsp. tauschii] ref|XP_020199154.1| histone H3.2 [Aegilops tauschii subsp. tauschii] ref|XP_020201310.1| histone H3.2 [Aegilops tauschii subsp. tauschii] ref|XP_020147519.1| histone H3.2 [Aegilops tauschii subsp. tauschii] ref|XP_020147521.1| histone H3.2 [Aegilops tauschii subsp. tauschii] ref|XP_020148653.1| histone H3.2 [Aegilops tauschii subsp. tauschii] ref|XP_020152971.1| histone H3.2 [Aegilops tauschii subsp. tauschii] ref|XP_020152973.1| histone H3.2 [Aegilops tauschii subsp. tauschii] ref|XP_020159543.1| histone H3.2 [Aegilops tauschii subsp. tauschii] ref|XP_020164950.1| histone H3.2 [Aegilops tauschii subsp. tauschii] ref|XP_020167501.1| histone H3.2 [Aegilops tauschii subsp. tauschii] ref|XP_020168907.1| histone H3.2 [Aegilops tauschii subsp. tauschii] ref|XP_020168911.1| histone H3.2 [Aegilops tauschii subsp. tauschii] ref|XP_020168913.1| histone H3.2 [Aegilops tauschii subsp. tauschii] ref|XP_020174885.1| histone H3.2 [Aegilops tauschii subsp. tauschii] ref|XP_020176163.1| histone H3.2 [Aegilops tauschii subsp. tauschii] ref|XP_020176164.1| histone H3.2 [Aegilops tauschii subsp. tauschii] ref|XP_020176165.1| histone H3.2 [Aegilops tauschii subsp. tauschii] ref|XP_020214134.1| histone H3.2 [Cajanus cajan] ref|XP_020215283.1| histone H3.2 [Cajanus cajan] ref|XP_020215284.1| histone H3.2 [Cajanus cajan] ref|XP_020215537.1| histone H3.2 [Cajanus cajan] ref|XP_020218992.1| histone H3.2 [Cajanus cajan] ref|XP_020223151.1| histone H3.2 [Cajanus cajan] ref|XP_020223261.1| histone H3.2 [Cajanus cajan] ref|XP_020524217.1| histone H3.2 [Amborella trichopoda] ref|XP_022154130.1| histone H3.2 [Momordica charantia] ref|XP_022954335.1| histone H3.2 [Cucurbita moschata] ref|XP_022959729.1| histone H3.2 [Cucurbita moschata] ref|XP_022991937.1| histone H3.2 [Cucurbita maxima] ref|XP_023004689.1| histone H3.2 [Cucurbita maxima] ref|XP_023549252.1| histone H3.2 [Cucurbita pepo subsp. pepo] ref|XP_023514058.1| histone H3.2 [Cucurbita pepo subsp. pepo] ref|XP_023916465.1| histone H3.2 [Quercus suber] sp|P68427.2|H32_PEA RecName: Full=Histone H3.2 sp|P68428.2|H32_WHEAT RecName: Full=Histone H3.2 sp|P68429.2|H32_MEDSA RecName: Full=Histone H3.2; AltName: Full=Histone H3.1; AltName: Full=Major histone H3 sp|P68430.2|H32_ONOVI RecName: Full=Histone H3.2 emb|CAA31964.1| unnamed protein product [Medicago sativa] emb|CAA31965.1| unnamed protein product [Medicago sativa] emb|CAA25451.1| unnamed protein product [Triticum aestivum] gb|AAB49545.1| histone H3.1 [Medicago sativa] gb|AAB81995.1| histone H3 [Onobrychis viciifolia] gb|ACG24791.1| histone H3 [Zea mays] gb|ACG27393.1| histone H3 [Zea mays] gb|ACG33231.1| histone H3 [Zea mays] gb|ACJ86155.1| unknown [Medicago truncatula] gb|ACU14577.1| unknown [Glycine max] gb|ACZ74621.1| histone H3-like protein [Wolffia arrhiza] gb|ADE76568.1| unknown [Picea sitchensis] gb|ADE76659.1| unknown [Picea sitchensis] dbj|BAK05448.1| predicted protein [Hordeum vulgare subsp. vulgare] dbj|BAJ85119.1| predicted protein [Hordeum vulgare subsp. vulgare] dbj|BAJ85969.1| predicted protein [Hordeum vulgare subsp. vulgare] dbj|BAJ88067.1| predicted protein [Hordeum vulgare subsp. vulgare] dbj|BAK07978.1| predicted protein [Hordeum vulgare subsp. vulgare] dbj|BAK01074.1| predicted protein [Hordeum vulgare subsp. vulgare] dbj|BAK04806.1| predicted protein [Hordeum vulgare subsp. vulgare] gb|AES79199.1| core histone H2A/H2B/H3/H4 [Medicago truncatula] gb|AES95814.1| core histone H2A/H2B/H3/H4 [Medicago truncatula] gb|AET03167.1| core histone H2A/H2B/H3/H4 [Medicago truncatula] gb|AET04661.1| core histone H2A/H2B/H3/H4 [Medicago truncatula] gb|AFK40853.1| unknown [Medicago truncatula] gb|AFK41087.1| unknown [Medicago truncatula] gb|AFK42486.1| unknown [Medicago truncatula] gb|AFK42592.1| unknown [Lotus japonicus] gb|AFK43073.1| unknown [Medicago truncatula] gb|AFK47036.1| unknown [Medicago truncatula] gb|ERN08186.1| hypothetical protein AMTR_s00018p00168040 [Amborella trichopoda] gb|ESW03980.1| hypothetical protein PHAVU_011G057200g [Phaseolus vulgaris] gb|ESW05527.1| hypothetical protein PHAVU_011G187100g [Phaseolus vulgaris] gb|ESW11482.1| hypothetical protein PHAVU_008G033700g [Phaseolus vulgaris] gb|ESW25888.1| hypothetical protein PHAVU_003G073800g [Phaseolus vulgaris] gb|ESW31803.1| hypothetical protein PHAVU_002G269200g [Phaseolus vulgaris] gb|ESW31804.1| hypothetical protein PHAVU_002G269300g [Phaseolus vulgaris] gb|AET04671.2| core histone H2A/H2B/H3/H4 [Medicago truncatula] gb|KEH21352.1| core histone H2A/H2B/H3/H4 [Medicago truncatula] gb|AES95809.2| core histone H2A/H2B/H3/H4 [Medicago truncatula] gb|KEH30259.1| core histone H2A/H2B/H3/H4 [Medicago truncatula] gb|KEH30956.1| core histone H2A/H2B/H3/H4 [Medicago truncatula] gb|AES65091.2| core histone H2A/H2B/H3/H4 [Medicago truncatula] emb|CDM83919.1| unnamed protein product [Triticum aestivum] gb|KHN21882.1| Histone H3.2 [Glycine soja] gb|KHN30118.1| Histone H3.2 [Glycine soja] gb|KHN34049.1| Histone H3.2 [Glycine soja] gb|KOM28572.1| hypothetical protein LR48_Vigan553s000100 [Vigna angularis] gb|KOM30612.1| hypothetical protein LR48_Vigan01g016600 [Vigna angularis] gb|KOM30613.1| hypothetical protein LR48_Vigan01g016700 [Vigna angularis] gb|KOM44347.1| hypothetical protein LR48_Vigan05g195200 [Vigna angularis] gb|KOM50778.1| hypothetical protein LR48_Vigan08g160500 [Vigna angularis] gb|KQJ86807.1| hypothetical protein BRADI_4g07840v3 [Brachypodium distachyon] gb|KQJ99805.1| hypothetical protein BRADI_3g45290v3 [Brachypodium distachyon] gb|KQK05154.1| hypothetical protein BRADI_2g18410v3 [Brachypodium distachyon] gb|KQK06043.1| hypothetical protein BRADI_2g24080v3 [Brachypodium distachyon] gb|KQK06659.1| hypothetical protein BRADI_2g27720v3 [Brachypodium distachyon] gb|KRH01274.1| hypothetical protein GLYMA_18G266200 [Glycine max] gb|KRH10171.1| hypothetical protein GLYMA_15G032300 [Glycine max] gb|KRH13201.1| hypothetical protein GLYMA_15G222200 [Glycine max] gb|KRH20364.1| hypothetical protein GLYMA_13G173100 [Glycine max] gb|KRH23165.1| hypothetical protein GLYMA_13G342000 [Glycine max] gb|KRH24676.1| hypothetical protein GLYMA_12G055200 [Glycine max] gb|KRH29676.1| hypothetical protein GLYMA_11G130900 [Glycine max] gb|KRH44719.1| hypothetical protein GLYMA_08G227400 [Glycine max] gb|KRH45024.1| hypothetical protein GLYMA_08G245000 [Glycine max] gb|KRH50131.1| hypothetical protein GLYMA_07G202500 [Glycine max] gb|KRH59532.1| hypothetical protein GLYMA_05G188600 [Glycine max] gb|KRH59533.1| hypothetical protein GLYMA_05G188700 [Glycine max] dbj|BAT89624.1| hypothetical protein VIGAN_06062200 [Vigna angularis var. angularis] dbj|BAT90796.1| hypothetical protein VIGAN_06208200 [Vigna angularis var. angularis] dbj|BAT91809.1| hypothetical protein VIGAN_07044200 [Vigna angularis var. angularis] dbj|BAT73288.1| hypothetical protein VIGAN_01076100 [Vigna angularis var. angularis] dbj|BAT83293.1| hypothetical protein VIGAN_04042100 [Vigna angularis var. angularis] gb|KYP58467.1| Histone H3.2 [Cajanus cajan] gb|KYP64743.1| Histone H3.2 [Cajanus cajan] gb|KYP68236.1| Histone H3.2 [Cajanus cajan] gb|KYP68241.1| Histone H3.2 [Cajanus cajan] gb|KYP68244.1| Histone H3.2 [Cajanus cajan] dbj|GAU48717.1| hypothetical protein TSUD_87150 [Trifolium subterraneum] dbj|GAU41454.1| hypothetical protein TSUD_237030 [Trifolium subterraneum] dbj|GAU41456.1| hypothetical protein TSUD_237060 [Trifolium subterraneum] dbj|GAU35062.1| hypothetical protein TSUD_69850 [Trifolium subterraneum] dbj|GAU35063.1| hypothetical protein TSUD_69860 [Trifolium subterraneum] dbj|GAU30973.1| hypothetical protein TSUD_63840 [Trifolium subterraneum] dbj|GAU26009.1| hypothetical protein TSUD_63970 [Trifolium subterraneum] dbj|GAU19848.1| hypothetical protein TSUD_170740 [Trifolium subterraneum] dbj|GAU19850.1| hypothetical protein TSUD_170760 [Trifolium subterraneum] dbj|GAU14118.1| hypothetical protein TSUD_169430 [Trifolium subterraneum] gb|OIV89496.1| hypothetical protein TanjilG_20561 [Lupinus angustifolius] gb|OIV93236.1| hypothetical protein TanjilG_27415 [Lupinus angustifolius] gb|OIV96988.1| hypothetical protein TanjilG_31879 [Lupinus angustifolius] gb|OIV97129.1| hypothetical protein TanjilG_00158 [Lupinus angustifolius] gb|OIW00460.1| hypothetical protein TanjilG_05810 [Lupinus angustifolius] gb|OIW03732.1| hypothetical protein TanjilG_30008 [Lupinus angustifolius] gb|OIW03733.1| hypothetical protein TanjilG_30009 [Lupinus angustifolius] gb|OIW08957.1| hypothetical protein TanjilG_05933 [Lupinus angustifolius] gb|OIW15358.1| hypothetical protein TanjilG_26731 [Lupinus angustifolius] gb|OIW17835.1| hypothetical protein TanjilG_02463 [Lupinus angustifolius] gb|AQK71552.1| Histone H3 [Zea mays] gb|AQK99256.1| Histone H3.2 [Zea mays] emb|SBO16021.1| PREDICTED: histone H3 [Lupinus angustifolius] gb|PNT38328.1| hypothetical protein POPTR_005G233900v3 [Populus trichocarpa] gb|PNX56033.1| histone H3-like protein [Trifolium pratense] gb|PNX78467.1| histone H3-like protein [Trifolium pratense] gb|PNX84664.1| histone H3-like protein [Trifolium pratense] gb|PNX85248.1| histone H3-like protein [Trifolium pratense] gb|PNY16305.1| histone H3-like protein [Trifolium pratense] gb|PNY18131.1| histone H3-like protein [Trifolium pratense] gb|POF05501.1| histone H3.2 [Quercus suber] Length = 136 Score = 261 bits (668), Expect = 1e-87 Identities = 135/135 (100%), Positives = 135/135 (100%) Frame = -3 Query: 511 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 332 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL Sbjct: 2 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 61 Query: 331 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 152 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM Sbjct: 62 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 121 Query: 151 PKDIQLARRIRGERA 107 PKDIQLARRIRGERA Sbjct: 122 PKDIQLARRIRGERA 136 >gb|KYP58465.1| Histone H3.2, partial [Cajanus cajan] Length = 140 Score = 261 bits (668), Expect = 1e-87 Identities = 135/135 (100%), Positives = 135/135 (100%) Frame = -3 Query: 511 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 332 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL Sbjct: 6 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 65 Query: 331 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 152 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM Sbjct: 66 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 125 Query: 151 PKDIQLARRIRGERA 107 PKDIQLARRIRGERA Sbjct: 126 PKDIQLARRIRGERA 140 >ref|XP_020195127.1| histone H3.2-like [Aegilops tauschii subsp. tauschii] Length = 136 Score = 261 bits (666), Expect = 3e-87 Identities = 134/135 (99%), Positives = 135/135 (100%) Frame = -3 Query: 511 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 332 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL Sbjct: 2 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 61 Query: 331 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 152 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVG+FEDTNLCAIHAKRVTIM Sbjct: 62 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGMFEDTNLCAIHAKRVTIM 121 Query: 151 PKDIQLARRIRGERA 107 PKDIQLARRIRGERA Sbjct: 122 PKDIQLARRIRGERA 136 >ref|XP_020168912.1| histone H3.2-like [Aegilops tauschii subsp. tauschii] Length = 136 Score = 260 bits (665), Expect = 4e-87 Identities = 134/135 (99%), Positives = 135/135 (100%) Frame = -3 Query: 511 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 332 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL Sbjct: 2 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 61 Query: 331 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 152 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQ+AAEAYLVGLFEDTNLCAIHAKRVTIM Sbjct: 62 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQDAAEAYLVGLFEDTNLCAIHAKRVTIM 121 Query: 151 PKDIQLARRIRGERA 107 PKDIQLARRIRGERA Sbjct: 122 PKDIQLARRIRGERA 136 >ref|XP_019199849.1| PREDICTED: histone H3.2-like [Ipomoea nil] Length = 136 Score = 260 bits (665), Expect = 4e-87 Identities = 134/135 (99%), Positives = 135/135 (100%) Frame = -3 Query: 511 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 332 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL Sbjct: 2 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 61 Query: 331 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 152 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM Sbjct: 62 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 121 Query: 151 PKDIQLARRIRGERA 107 PKD+QLARRIRGERA Sbjct: 122 PKDMQLARRIRGERA 136 >ref|NP_189372.1| Histone superfamily protein [Arabidopsis thaliana] ref|NP_201339.1| Histone superfamily protein [Arabidopsis thaliana] ref|NP_563838.1| Histone superfamily protein [Arabidopsis thaliana] ref|NP_568227.1| Histone superfamily protein [Arabidopsis thaliana] ref|NP_568228.1| Histone superfamily protein [Arabidopsis thaliana] ref|NP_001131276.1| histone H3.2 [Zea mays] ref|XP_002299242.1| histone H3 family protein [Populus trichocarpa] ref|XP_002304754.1| hypothetical protein POPTR_0003s22120g [Populus trichocarpa] ref|XP_002282606.1| PREDICTED: histone H3.2 [Vitis vinifera] ref|XP_002285556.1| PREDICTED: histone H3.2 [Vitis vinifera] ref|XP_002285562.1| PREDICTED: histone H3.2 [Vitis vinifera] ref|XP_002264961.1| PREDICTED: histone H3.2 [Vitis vinifera] ref|XP_002457320.1| histone H3.2 [Sorghum bicolor] ref|XP_002452234.1| histone H3.2 [Sorghum bicolor] ref|XP_002446458.1| histone H3.2 [Sorghum bicolor] ref|XP_002447846.1| histone H3.2 [Sorghum bicolor] ref|XP_002441172.1| histone H3.2 [Sorghum bicolor] ref|XP_002436522.1| histone H3.2 [Sorghum bicolor] ref|XP_002437869.1| histone H3.2 [Sorghum bicolor] ref|XP_002522502.1| PREDICTED: histone H3.2 [Ricinus communis] ref|XP_002524630.1| PREDICTED: histone H3.2 [Ricinus communis] ref|XP_002533558.1| PREDICTED: histone H3.2 [Ricinus communis] ref|XP_002533561.1| PREDICTED: histone H3.2 [Ricinus communis] ref|XP_002533563.1| PREDICTED: histone H3.2 [Ricinus communis] ref|XP_002533564.1| PREDICTED: histone H3.2 [Ricinus communis] ref|XP_002873454.1| histone H3.2 [Arabidopsis lyrata subsp. lyrata] ref|XP_002894648.1| histone H3.2 [Arabidopsis lyrata subsp. lyrata] ref|XP_004142133.1| PREDICTED: histone H3.2 [Cucumis sativus] ref|XP_004229355.1| PREDICTED: histone H3.2 [Solanum lycopersicum] ref|XP_004229356.1| PREDICTED: histone H3.2 [Solanum lycopersicum] ref|XP_004229488.1| PREDICTED: histone H3.2 [Solanum lycopersicum] ref|XP_004248123.1| PREDICTED: histone H3.2 [Solanum lycopersicum] ref|XP_004293906.1| PREDICTED: histone H3.2 [Fragaria vesca subsp. vesca] ref|XP_004294584.1| PREDICTED: histone H3.2 [Fragaria vesca subsp. vesca] ref|XP_004294793.1| PREDICTED: histone H3.2 [Fragaria vesca subsp. vesca] ref|XP_004295221.1| PREDICTED: histone H3.2 [Fragaria vesca subsp. vesca] ref|XP_004300433.1| PREDICTED: histone H3.2 [Fragaria vesca subsp. vesca] ref|XP_004952690.1| histone H3.2 [Setaria italica] ref|XP_004970697.1| histone H3.2 [Setaria italica] ref|XP_004975679.1| histone H3.2 [Setaria italica] ref|XP_006359169.1| PREDICTED: histone H3.2 [Solanum tuberosum] ref|XP_006359170.1| PREDICTED: histone H3.2 [Solanum tuberosum] ref|XP_006361042.1| PREDICTED: histone H3.2 [Solanum tuberosum] ref|XP_006364319.1| PREDICTED: histone H3.2 [Solanum tuberosum] ref|XP_006365266.1| PREDICTED: histone H3.2 [Solanum tuberosum] ref|XP_006366504.1| PREDICTED: histone H3.2 [Solanum tuberosum] ref|XP_006366505.1| PREDICTED: histone H3.2 [Solanum tuberosum] ref|XP_006292533.1| histone H3.2 [Capsella rubella] ref|XP_006304637.1| histone H3.2 [Capsella rubella] ref|XP_006386195.1| hypothetical protein POPTR_0002s03030g [Populus trichocarpa] ref|XP_006386111.1| hypothetical protein POPTR_0003s22240g [Populus trichocarpa] ref|XP_002320408.2| hypothetical protein POPTR_0014s09260g [Populus trichocarpa] ref|XP_006394044.1| histone H3.2 [Eutrema salsugineum] ref|XP_006394194.1| histone H3.2 [Eutrema salsugineum] ref|XP_006396911.1| histone H3.2 [Eutrema salsugineum] ref|XP_006426310.1| histone H3.2 [Citrus clementina] ref|XP_006446007.1| histone H3.2 [Citrus clementina] ref|XP_006446012.1| histone H3.2 [Citrus clementina] ref|XP_006446027.1| histone H3.2 [Citrus clementina] ref|XP_006466277.1| PREDICTED: histone H3.2 [Citrus sinensis] ref|XP_006493650.1| PREDICTED: histone H3.2 [Citrus sinensis] ref|XP_006493653.1| PREDICTED: histone H3.2 isoform X1 [Citrus sinensis] ref|XP_006493654.1| PREDICTED: histone H3.2 isoform X2 [Citrus sinensis] ref|XP_006493658.1| PREDICTED: histone H3.2 isoform X1 [Citrus sinensis] ref|XP_006493659.1| PREDICTED: histone H3.2 isoform X2 [Citrus sinensis] ref|XP_006656199.1| PREDICTED: histone H3.2 [Oryza brachyantha] ref|XP_006662745.1| PREDICTED: histone H3.2 [Oryza brachyantha] ref|XP_006827607.1| histone H3.2 [Amborella trichopoda] ref|XP_006854535.1| histone H3.2 [Amborella trichopoda] ref|XP_007014937.1| PREDICTED: histone H3.2 [Theobroma cacao] ref|XP_007047838.1| PREDICTED: histone H3.2 [Theobroma cacao] ref|XP_007206130.1| histone H3.2 [Prunus persica] ref|XP_007206131.1| histone H3.2 [Prunus persica] ref|XP_007213974.1| histone H3.2 [Prunus persica] ref|XP_008219239.1| PREDICTED: histone H3.2 [Prunus mume] ref|XP_008219284.1| PREDICTED: histone H3.2 [Prunus mume] ref|XP_008243610.1| PREDICTED: histone H3.2 [Prunus mume] ref|XP_008245364.1| PREDICTED: histone H3.2 [Prunus mume] ref|XP_008383674.1| PREDICTED: histone H3.2 [Malus domestica] ref|XP_008384460.1| PREDICTED: histone H3.2 [Malus domestica] ref|XP_008384469.1| PREDICTED: histone H3.2 [Malus domestica] ref|XP_008349461.1| PREDICTED: histone H3.2 [Malus domestica] ref|XP_008358867.1| PREDICTED: histone H3.2 [Malus domestica] ref|XP_008366176.1| PREDICTED: histone H3.2 [Malus domestica] ref|XP_008449740.1| PREDICTED: histone H3.2 [Cucumis melo] ref|XP_008466947.1| PREDICTED: histone H3.2 [Cucumis melo] ref|XP_008678686.1| histone H3.2 [Zea mays] ref|XP_008659267.1| histone H3.2 [Zea mays] ref|XP_008777421.1| PREDICTED: histone H3.2 [Phoenix dactylifera] ref|XP_008781402.1| PREDICTED: histone H3.2 [Phoenix dactylifera] ref|XP_008793940.1| PREDICTED: histone H3.2 [Phoenix dactylifera] ref|XP_009125303.1| PREDICTED: histone H3.2 [Brassica rapa] ref|XP_009131154.1| PREDICTED: histone H3.2 [Brassica rapa] ref|XP_009110843.1| PREDICTED: histone H3.2 [Brassica rapa] ref|XP_009112178.1| PREDICTED: histone H3.2 [Brassica rapa] ref|XP_009114048.1| PREDICTED: histone H3.2 [Brassica rapa] ref|XP_009374897.1| PREDICTED: histone H3.2 [Pyrus x bretschneideri] ref|XP_009352838.1| PREDICTED: histone H3.2 [Pyrus x bretschneideri] ref|XP_009364707.1| PREDICTED: histone H3.2 [Pyrus x bretschneideri] ref|XP_009364738.1| PREDICTED: histone H3.2 [Pyrus x bretschneideri] ref|XP_009379413.1| PREDICTED: histone H3.2 [Pyrus x bretschneideri] ref|XP_009418349.1| PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis] ref|XP_009399186.1| PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis] ref|XP_009404906.1| PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis] ref|XP_009405329.1| PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis] ref|XP_009411937.1| PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis] ref|XP_009420590.1| PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis] ref|XP_009612389.1| PREDICTED: histone H3.2 [Nicotiana tomentosiformis] ref|XP_009588612.1| PREDICTED: histone H3.2 [Nicotiana tomentosiformis] ref|XP_009588620.1| PREDICTED: histone H3.2 [Nicotiana tomentosiformis] ref|XP_009589159.1| PREDICTED: histone H3.2 [Nicotiana tomentosiformis] ref|XP_009594168.1| PREDICTED: histone H3.2 [Nicotiana tomentosiformis] ref|XP_009597397.1| PREDICTED: histone H3.2 [Nicotiana tomentosiformis] ref|XP_009795193.1| PREDICTED: histone H3.2 [Nicotiana sylvestris] ref|XP_009790377.1| PREDICTED: histone H3.2 [Nicotiana sylvestris] ref|XP_009792014.1| PREDICTED: histone H3.2 [Nicotiana sylvestris] ref|XP_009794411.1| PREDICTED: histone H3.2 [Nicotiana sylvestris] ref|XP_009794577.1| PREDICTED: histone H3.2 [Nicotiana sylvestris] ref|XP_009800087.1| PREDICTED: histone H3.2 [Nicotiana sylvestris] ref|XP_009768852.1| PREDICTED: histone H3.2 [Nicotiana sylvestris] ref|XP_009776512.1| PREDICTED: histone H3.2 [Nicotiana sylvestris] ref|XP_010044997.1| PREDICTED: histone H3.2 [Eucalyptus grandis] ref|XP_010031842.1| PREDICTED: histone H3.2 [Eucalyptus grandis] ref|XP_010033130.1| PREDICTED: histone H3.2 [Eucalyptus grandis] ref|XP_010087371.1| histone H3.2 [Morus notabilis] ref|XP_010087372.1| histone H3.2 [Morus notabilis] ref|XP_010091983.1| histone H3.2 [Morus notabilis] ref|XP_010091985.1| histone H3.2 [Morus notabilis] ref|XP_010111157.1| histone H3.2 [Morus notabilis] ref|XP_010257371.1| PREDICTED: histone H3.2 [Nelumbo nucifera] ref|XP_010257381.1| PREDICTED: histone H3.2 [Nelumbo nucifera] ref|XP_010258545.1| PREDICTED: histone H3.2 [Nelumbo nucifera] ref|XP_010260368.1| PREDICTED: histone H3.2 [Nelumbo nucifera] ref|XP_010260930.1| PREDICTED: histone H3.2 [Nelumbo nucifera] ref|XP_010263130.1| PREDICTED: histone H3.2 [Nelumbo nucifera] ref|XP_010265797.1| PREDICTED: histone H3.2 [Nelumbo nucifera] ref|XP_010241721.1| PREDICTED: histone H3.2 [Nelumbo nucifera] ref|XP_010324306.1| PREDICTED: histone H3.2 [Solanum lycopersicum] ref|XP_010316780.1| PREDICTED: histone H3.2 [Solanum lycopersicum] ref|XP_010463183.1| PREDICTED: histone H3.2 [Camelina sativa] ref|XP_010489841.1| PREDICTED: histone H3.2 [Camelina sativa] ref|XP_010502711.1| PREDICTED: histone H3.2 [Camelina sativa] ref|XP_010514443.1| PREDICTED: histone H3.2 [Camelina sativa] ref|XP_010425488.1| PREDICTED: histone H3.2 [Camelina sativa] ref|XP_010444536.1| PREDICTED: histone H3.2 [Camelina sativa] ref|XP_010458200.1| PREDICTED: histone H3.2 [Camelina sativa] ref|XP_010475747.1| PREDICTED: histone H3.2 [Camelina sativa] ref|XP_010484375.1| PREDICTED: histone H3.2 [Camelina sativa] ref|XP_010536065.1| PREDICTED: histone H3.2 [Tarenaya hassleriana] ref|XP_010544196.1| PREDICTED: histone H3.2 [Tarenaya hassleriana] ref|XP_010673587.1| PREDICTED: histone H3.2 [Beta vulgaris subsp. vulgaris] ref|XP_010673590.1| PREDICTED: histone H3.2 [Beta vulgaris subsp. vulgaris] ref|XP_010675450.1| PREDICTED: histone H3.2 [Beta vulgaris subsp. vulgaris] ref|XP_010675457.1| PREDICTED: histone H3.2 [Beta vulgaris subsp. vulgaris] ref|XP_010675458.1| PREDICTED: histone H3.2 [Beta vulgaris subsp. vulgaris] ref|XP_010679903.1| PREDICTED: histone H3.2 [Beta vulgaris subsp. vulgaris] ref|XP_010911970.1| PREDICTED: histone H3.2 [Elaeis guineensis] ref|XP_010912408.1| PREDICTED: histone H3.2 [Elaeis guineensis] ref|XP_011037963.1| PREDICTED: histone H3.2 [Populus euphratica] ref|XP_010930992.1| PREDICTED: histone H3.2 [Elaeis guineensis] ref|XP_011028938.1| PREDICTED: histone H3.2 [Populus euphratica] ref|XP_010904890.1| PREDICTED: histone H3.2 [Elaeis guineensis] ref|XP_011037873.1| PREDICTED: histone H3.2 [Populus euphratica] ref|XP_011037877.1| PREDICTED: histone H3.2 [Populus euphratica] ref|XP_011042066.1| PREDICTED: histone H3.2 [Populus euphratica] ref|XP_011042070.1| PREDICTED: histone H3.2 [Populus euphratica] ref|XP_011087280.1| histone H3.2 [Sesamum indicum] ref|XP_011080254.1| histone H3.2 [Sesamum indicum] ref|XP_011090392.1| histone H3.2 [Sesamum indicum] ref|XP_011092467.1| histone H3.2 [Sesamum indicum] ref|XP_011093538.1| histone H3.2 [Sesamum indicum] ref|XP_011463287.1| PREDICTED: histone H3.2 [Fragaria vesca subsp. vesca] ref|XP_004139024.2| PREDICTED: histone H3.2 [Cucumis sativus] ref|XP_012071958.1| histone H3.2 [Jatropha curcas] ref|XP_012091683.1| histone H3.2 [Jatropha curcas] ref|XP_012092773.1| histone H3.2 [Jatropha curcas] ref|XP_012092775.1| histone H3.2 [Jatropha curcas] ref|XP_012473340.1| PREDICTED: histone H3.2 [Gossypium raimondii] ref|XP_012477143.1| PREDICTED: histone H3.2 [Gossypium raimondii] ref|XP_012477145.1| PREDICTED: histone H3.2 [Gossypium raimondii] ref|XP_012447072.1| PREDICTED: histone H3.2 [Gossypium raimondii] ref|XP_012452274.1| PREDICTED: histone H3.2 [Gossypium raimondii] ref|XP_012455372.1| PREDICTED: histone H3.2 [Gossypium raimondii] ref|XP_012456013.1| PREDICTED: histone H3.2 [Gossypium raimondii] ref|XP_012464460.1| PREDICTED: histone H3.2 [Gossypium raimondii] ref|XP_012465103.1| PREDICTED: histone H3.2 [Gossypium raimondii] ref|XP_012700296.1| histone H3.2 [Setaria italica] ref|XP_012700964.1| histone H3.2 [Setaria italica] ref|XP_012829914.1| PREDICTED: histone H3.2 [Erythranthe guttata] ref|XP_012830336.1| PREDICTED: histone H3.2 [Erythranthe guttata] ref|XP_012835372.1| PREDICTED: histone H3.2 [Erythranthe guttata] ref|XP_012849881.1| PREDICTED: histone H3.2 [Erythranthe guttata] ref|XP_012828407.1| PREDICTED: histone H3.2 [Erythranthe guttata] ref|XP_012829025.1| PREDICTED: histone H3.2 [Erythranthe guttata] ref|XP_013618388.1| PREDICTED: histone H3.2 [Brassica oleracea var. oleracea] ref|XP_013621521.1| PREDICTED: histone H3.2 [Brassica oleracea var. oleracea] ref|XP_013637372.1| PREDICTED: histone H3.2 [Brassica oleracea var. oleracea] ref|XP_013599938.1| PREDICTED: histone H3.2 [Brassica oleracea var. oleracea] ref|XP_013606481.1| PREDICTED: histone H3.2 [Brassica oleracea var. oleracea] ref|XP_013609086.1| PREDICTED: histone H3.2 [Brassica oleracea var. oleracea] ref|XP_013678750.1| histone H3.2 [Brassica napus] ref|XP_013726586.1| histone H3.2 [Brassica napus] ref|XP_013738537.1| histone H3.2 [Brassica napus] ref|XP_013742827.1| histone H3.2 [Brassica napus] ref|XP_013742828.1| histone H3.2 [Brassica napus] ref|XP_013750874.1| histone H3.2 [Brassica napus] ref|XP_013657686.1| histone H3.2 [Brassica napus] ref|XP_013680280.1| histone H3.2 [Brassica napus] ref|XP_013686742.1| histone H3.2 [Brassica napus] ref|XP_013686753.1| histone H3.2 [Brassica napus] ref|XP_013698649.1| histone H3.2 [Brassica napus] ref|XP_013700674.1| histone H3.2 [Brassica napus] ref|XP_013700675.1| histone H3.2 [Brassica napus] ref|XP_013700676.1| histone H3.2 [Brassica napus] ref|XP_013712760.1| histone H3.2 [Brassica napus] ref|XP_013718218.1| histone H3.2 [Brassica napus] ref|XP_013718219.1| histone H3.2 [Brassica napus] ref|XP_013731494.1| histone H3.2 [Brassica napus] ref|XP_013733475.1| histone H3.2 [Brassica napus] ref|XP_014660475.1| histone H3.2 [Setaria italica] ref|XP_015062471.1| PREDICTED: histone H3.2 [Solanum pennellii] ref|XP_015062551.1| PREDICTED: histone H3.2 [Solanum pennellii] ref|XP_015060267.1| PREDICTED: histone H3.2 [Solanum pennellii] ref|XP_015060270.1| PREDICTED: histone H3.2 [Solanum pennellii] ref|XP_015063022.1| PREDICTED: histone H3.2 [Solanum pennellii] ref|XP_015063120.1| PREDICTED: histone H3.2 [Solanum pennellii] ref|XP_015066930.1| PREDICTED: histone H3.2 [Solanum pennellii] ref|XP_015088813.1| PREDICTED: histone H3.2 [Solanum pennellii] ref|XP_015641515.1| PREDICTED: histone H3.2 [Oryza sativa Japonica Group] ref|XP_015639714.1| PREDICTED: histone H3.2 [Oryza sativa Japonica Group] ref|XP_015642925.1| PREDICTED: histone H3.2 [Oryza sativa Japonica Group] ref|XP_015642926.1| PREDICTED: histone H3.2 [Oryza sativa Japonica Group] ref|XP_015642927.1| PREDICTED: histone H3.2 [Oryza sativa Japonica Group] ref|XP_015615109.1| PREDICTED: histone H3.2 [Oryza sativa Japonica Group] ref|XP_015890987.1| PREDICTED: histone H3.2 [Ziziphus jujuba] ref|XP_015875930.1| PREDICTED: histone H3.2 [Ziziphus jujuba] ref|XP_015867123.1| PREDICTED: histone H3.2 [Ziziphus jujuba] ref|XP_015867128.1| PREDICTED: histone H3.2 [Ziziphus jujuba] ref|XP_015956408.1| histone H3.2 [Arachis duranensis] ref|XP_015962680.1| histone H3.2 [Arachis duranensis] ref|XP_015945242.1| histone H3.2 [Arachis duranensis] ref|XP_016190032.1| histone H3.2 [Arachis ipaensis] ref|XP_016194363.1| histone H3.2 [Arachis ipaensis] ref|XP_016181780.1| histone H3.2 [Arachis ipaensis] ref|XP_016182163.1| histone H3.2 [Arachis ipaensis] ref|XP_016444277.1| PREDICTED: histone H3.2 [Nicotiana tabacum] ref|XP_016472604.1| PREDICTED: histone H3.2 [Nicotiana tabacum] ref|XP_016476898.1| PREDICTED: histone H3.2 [Nicotiana tabacum] ref|XP_016497746.1| PREDICTED: histone H3.2 [Nicotiana tabacum] ref|XP_016497344.1| PREDICTED: histone H3.2 [Nicotiana tabacum] ref|XP_016498067.1| PREDICTED: histone H3.2 [Nicotiana tabacum] ref|XP_016498068.1| PREDICTED: histone H3.2 [Nicotiana tabacum] ref|XP_016500339.1| PREDICTED: histone H3.2 [Nicotiana tabacum] ref|XP_016502252.1| PREDICTED: histone H3.2 [Nicotiana tabacum] ref|XP_016506905.1| PREDICTED: histone H3.2 [Nicotiana tabacum] ref|XP_016432905.1| PREDICTED: histone H3.2 [Nicotiana tabacum] ref|XP_016437038.1| PREDICTED: histone H3.2 [Nicotiana tabacum] ref|XP_016514570.1| PREDICTED: histone H3.2 [Nicotiana tabacum] ref|XP_016432553.1| PREDICTED: histone H3.2 [Nicotiana tabacum] ref|XP_016438522.1| PREDICTED: histone H3.2 [Nicotiana tabacum] ref|XP_016554942.1| PREDICTED: histone H3.2 [Capsicum annuum] ref|XP_016557393.1| PREDICTED: histone H3.2 [Capsicum annuum] ref|XP_016557394.1| PREDICTED: histone H3.2 [Capsicum annuum] ref|XP_016541463.1| PREDICTED: histone H3.2 [Capsicum annuum] ref|XP_016559802.1| PREDICTED: histone H3.2 [Capsicum annuum] ref|XP_016551871.1| PREDICTED: histone H3.2 [Capsicum annuum] ref|XP_016717625.1| PREDICTED: histone H3.2 [Gossypium hirsutum] ref|XP_016734760.1| PREDICTED: histone H3.2 [Gossypium hirsutum] ref|XP_016753413.1| PREDICTED: histone H3.2 [Gossypium hirsutum] ref|XP_016678479.1| PREDICTED: histone H3.2 [Gossypium hirsutum] ref|XP_016679592.1| PREDICTED: histone H3.2 [Gossypium hirsutum] ref|XP_016683567.1| PREDICTED: histone H3.2 [Gossypium hirsutum] ref|XP_016690176.1| PREDICTED: histone H3.2 [Gossypium hirsutum] ref|XP_016697979.1| PREDICTED: histone H3.2 [Gossypium hirsutum] ref|XP_016698756.1| PREDICTED: histone H3.2 [Gossypium hirsutum] ref|XP_016703464.1| PREDICTED: histone H3.2 [Gossypium hirsutum] ref|XP_016706622.1| PREDICTED: histone H3.2 [Gossypium hirsutum] ref|XP_017182452.1| PREDICTED: histone H3.2 [Malus domestica] ref|XP_017185745.1| PREDICTED: histone H3.2 [Malus domestica] ref|XP_017234420.1| PREDICTED: histone H3.2 [Daucus carota subsp. sativus] ref|XP_017236362.1| PREDICTED: histone H3.2 [Daucus carota subsp. sativus] ref|XP_017258634.1| PREDICTED: histone H3.2 [Daucus carota subsp. sativus] ref|XP_017232071.1| PREDICTED: histone H3.2 [Daucus carota subsp. sativus] ref|XP_017234599.1| PREDICTED: histone H3.2 [Daucus carota subsp. sativus] ref|XP_017234600.1| PREDICTED: histone H3.2 [Daucus carota subsp. sativus] ref|XP_017226888.1| PREDICTED: histone H3.2 [Daucus carota subsp. sativus] ref|XP_017621199.1| PREDICTED: histone H3.2 [Gossypium arboreum] ref|XP_017605698.1| PREDICTED: histone H3.2 [Gossypium arboreum] ref|XP_017643103.1| PREDICTED: histone H3.2 [Gossypium arboreum] ref|XP_017646801.1| PREDICTED: histone H3.2 [Gossypium arboreum] ref|XP_017648889.1| PREDICTED: histone H3.2 [Gossypium arboreum] ref|XP_017980785.1| PREDICTED: histone H3.2 [Theobroma cacao] ref|XP_017981975.1| PREDICTED: histone H3.2 [Theobroma cacao] ref|XP_007014942.2| PREDICTED: histone H3.2 [Theobroma cacao] ref|XP_018470661.1| PREDICTED: histone H3.2 [Raphanus sativus] ref|XP_018470662.1| PREDICTED: histone H3.2 [Raphanus sativus] ref|XP_018433979.1| PREDICTED: histone H3.2 [Raphanus sativus] ref|XP_018439713.1| PREDICTED: histone H3.2 [Raphanus sativus] ref|XP_018445234.1| PREDICTED: histone H3.2 [Raphanus sativus] ref|XP_018448989.1| PREDICTED: histone H3.2 [Raphanus sativus] ref|XP_018448990.1| PREDICTED: histone H3.2 [Raphanus sativus] ref|XP_018456938.1| PREDICTED: histone H3.2 [Raphanus sativus] ref|XP_018456939.1| PREDICTED: histone H3.2 [Raphanus sativus] ref|XP_018622827.1| PREDICTED: histone H3.2 [Nicotiana tomentosiformis] ref|XP_018727385.1| PREDICTED: histone H3.2 [Eucalyptus grandis] ref|XP_018851506.1| PREDICTED: histone H3.2 [Juglans regia] ref|XP_019059186.1| PREDICTED: histone H3.2 [Tarenaya hassleriana] ref|XP_019072373.1| PREDICTED: histone H3.2 [Vitis vinifera] ref|XP_019186829.1| PREDICTED: histone H3.2 [Ipomoea nil] ref|XP_019152654.1| PREDICTED: histone H3.2 [Ipomoea nil] ref|XP_019152661.1| PREDICTED: histone H3.2 [Ipomoea nil] ref|XP_019152669.1| PREDICTED: histone H3.2 [Ipomoea nil] ref|XP_019168898.1| PREDICTED: histone H3.2 [Ipomoea nil] ref|XP_019197722.1| PREDICTED: histone H3.2 [Ipomoea nil] ref|XP_019168634.1| PREDICTED: histone H3.2 [Ipomoea nil] ref|XP_019265433.1| PREDICTED: histone H3.2 [Nicotiana attenuata] ref|XP_019267355.1| PREDICTED: histone H3.2 [Nicotiana attenuata] ref|XP_019223782.1| PREDICTED: histone H3.2 [Nicotiana attenuata] ref|XP_019223783.1| PREDICTED: histone H3.2 [Nicotiana attenuata] ref|XP_019230430.1| PREDICTED: histone H3.2 [Nicotiana attenuata] ref|XP_019241236.1| PREDICTED: histone H3.2 [Nicotiana attenuata] ref|XP_019226053.1| PREDICTED: histone H3.2 [Nicotiana attenuata] ref|XP_019246841.1| PREDICTED: histone H3.2 [Nicotiana attenuata] ref|XP_019578994.1| PREDICTED: histone H3.2 [Rhinolophus sinicus] ref|XP_019579013.1| PREDICTED: histone H3.2 [Rhinolophus sinicus] ref|XP_019579046.1| PREDICTED: histone H3.2 [Rhinolophus sinicus] ref|XP_019579062.1| PREDICTED: histone H3.2 [Rhinolophus sinicus] ref|XP_020089911.1| histone H3.2 [Ananas comosus] ref|XP_020090239.1| histone H3.2 [Ananas comosus] ref|XP_020111776.1| histone H3.2 [Ananas comosus] ref|XP_008663191.2| histone H3.2 [Zea mays] ref|XP_020401458.1| histone H3.2 [Zea mays] ref|XP_008669428.2| histone H3.2 [Zea mays] ref|XP_020405898.1| histone H3.2 [Zea mays] ref|XP_020394886.1| histone H3.2 [Zea mays] ref|XP_020421876.1| histone H3.2 [Prunus persica] ref|XP_011088023.2| histone H3.2 [Sesamum indicum] ref|XP_020867896.1| histone H3.2 [Arabidopsis lyrata subsp. lyrata] ref|XP_002877046.2| histone H3.2 [Arabidopsis lyrata subsp. lyrata] ref|XP_020876762.1| histone H3.2 [Arabidopsis lyrata subsp. lyrata] ref|XP_021300861.1| histone H3.2 [Herrania umbratica] ref|XP_021275975.1| histone H3.2 [Herrania umbratica] ref|XP_021278674.1| histone H3.2 [Herrania umbratica] ref|XP_021311652.1| histone H3.2 [Sorghum bicolor] ref|XP_021614994.1| histone H3.2 [Manihot esculenta] ref|XP_021629890.1| histone H3.2 [Manihot esculenta] ref|XP_021634528.1| histone H3.2 [Manihot esculenta] ref|XP_021597539.1| histone H3.2 [Manihot esculenta] ref|XP_021597540.1| histone H3.2 [Manihot esculenta] ref|XP_021601079.1| histone H3.2 [Manihot esculenta] ref|XP_021601080.1| histone H3.2 [Manihot esculenta] ref|XP_021636735.1| histone H3.2 [Hevea brasiliensis] ref|XP_021666493.1| histone H3.2 [Hevea brasiliensis] ref|XP_021671981.1| histone H3.2 [Hevea brasiliensis] ref|XP_021636402.1| histone H3.2 [Hevea brasiliensis] ref|XP_021639008.1| histone H3.2 [Hevea brasiliensis] ref|XP_021649553.1| histone H3.2 [Hevea brasiliensis] ref|XP_021649554.1| histone H3.2 [Hevea brasiliensis] ref|XP_021660493.1| histone H3.2 [Hevea brasiliensis] ref|XP_021761018.1| histone H3.2 [Chenopodium quinoa] ref|XP_021761196.1| histone H3.2 [Chenopodium quinoa] ref|XP_021771602.1| histone H3.2 [Chenopodium quinoa] ref|XP_021771603.1| histone H3.2 [Chenopodium quinoa] ref|XP_021772030.1| histone H3.2 [Chenopodium quinoa] ref|XP_021773746.1| histone H3.2 [Chenopodium quinoa] ref|XP_021773747.1| histone H3.2 [Chenopodium quinoa] ref|XP_021773748.1| histone H3.2 [Chenopodium quinoa] ref|XP_021719256.1| histone H3.2 [Chenopodium quinoa] ref|XP_021719258.1| histone H3.2 [Chenopodium quinoa] ref|XP_021719259.1| histone H3.2 [Chenopodium quinoa] ref|XP_021728938.1| histone H3.2 [Chenopodium quinoa] ref|XP_021813959.1| histone H3.2 [Prunus avium] ref|XP_021827292.1| histone H3.2 [Prunus avium] ref|XP_021830247.1| histone H3.2 [Prunus avium] ref|XP_021830879.1| histone H3.2 [Prunus avium] ref|XP_021853874.1| histone H3.2 [Spinacia oleracea] ref|XP_021860947.1| histone H3.2 [Spinacia oleracea] ref|XP_021863052.1| histone H3.2 [Spinacia oleracea] ref|XP_021843947.1| histone H3.2 [Spinacia oleracea] ref|XP_021843948.1| histone H3.2 [Spinacia oleracea] ref|XP_021857796.1| histone H3.2 [Spinacia oleracea] ref|XP_021894154.1| histone H3.2 [Carica papaya] ref|XP_021897494.1| histone H3.2 [Carica papaya] ref|XP_022148796.1| histone H3.2 [Momordica charantia] ref|XP_022150464.1| histone H3.2 [Momordica charantia] ref|XP_022552886.1| histone H3.2 [Brassica napus] ref|XP_022749699.1| histone H3.2 [Durio zibethinus] ref|XP_022751113.1| histone H3.2 [Durio zibethinus] ref|XP_022753552.1| histone H3.2 [Durio zibethinus] ref|XP_022754286.1| histone H3.2 [Durio zibethinus] ref|XP_022775007.1| histone H3.2 [Durio zibethinus] ref|XP_022729530.1| histone H3.2 [Durio zibethinus] ref|XP_022730499.1| histone H3.2 [Durio zibethinus] ref|XP_022739834.1| histone H3.2 [Durio zibethinus] ref|XP_022861044.1| histone H3.2 [Olea europaea var. sylvestris] ref|XP_022884247.1| histone H3.2 [Olea europaea var. sylvestris] ref|XP_022896559.1| histone H3.2 [Olea europaea var. sylvestris] ref|XP_022899180.1| histone H3.2 [Olea europaea var. sylvestris] ref|XP_022899181.1| histone H3.2 [Olea europaea var. sylvestris] ref|XP_022865383.1| histone H3.2 [Olea europaea var. sylvestris] ref|XP_022876676.1| histone H3.2 [Olea europaea var. sylvestris] ref|XP_022879070.1| histone H3.2 [Olea europaea var. sylvestris] ref|XP_022944489.1| histone H3.2 [Cucurbita moschata] ref|XP_022958666.1| histone H3.2 [Cucurbita moschata] ref|XP_022959728.1| histone H3.2 [Cucurbita moschata] ref|XP_022959793.1| histone H3.2 [Cucurbita moschata] ref|XP_022961291.1| histone H3.2 [Cucurbita moschata] ref|XP_022929903.1| histone H3.2 [Cucurbita moschata] ref|XP_022988234.1| histone H3.2 [Cucurbita maxima] ref|XP_022992435.1| histone H3.2 [Cucurbita maxima] ref|XP_022995169.1| histone H3.2 [Cucurbita maxima] ref|XP_023004688.1| histone H3.2 [Cucurbita maxima] ref|XP_023005085.1| histone H3.2 [Cucurbita maxima] ref|XP_023532072.1| histone H3.2 [Cucurbita pepo subsp. pepo] ref|XP_023511794.1| histone H3.2 [Cucurbita pepo subsp. pepo] ref|XP_023515063.1| histone H3.2 [Cucurbita pepo subsp. pepo] ref|XP_023515802.1| histone H3.2 [Cucurbita pepo subsp. pepo] ref|XP_006301260.2| histone H3.2 [Capsella rubella] ref|XP_023908460.1| histone H3.2 [Quercus suber] ref|XP_023908461.1| histone H3.2 [Quercus suber] ref|XP_023908480.1| histone H3.2 [Quercus suber] ref|XP_024012002.1| histone H3.2 [Eutrema salsugineum] ref|XP_024185577.1| histone H3.2 [Rosa chinensis] ref|XP_024157717.1| histone H3.2 [Rosa chinensis] ref|XP_024157718.1| histone H3.2 [Rosa chinensis] ref|XP_024157719.1| histone H3.2 [Rosa chinensis] ref|XP_024157720.1| histone H3.2 [Rosa chinensis] ref|XP_024158950.1| histone H3.2 [Rosa chinensis] ref|XP_024159430.1| histone H3.2 [Rosa chinensis] ref|XP_024159911.1| histone H3.2 [Rosa chinensis] sp|P59226.2|H32_ARATH RecName: Full=Histone H3.2; AltName: Full=Histone H3.1 sp|P69246.2|H32_MAIZE RecName: Full=Histone H3.2 sp|P69248.2|H32_PETCR RecName: Full=Histone H3.2 sp|Q71T45.3|H32_EUPES RecName: Full=Histone H3.2 sp|Q6LBE3.3|H32_ASPOF RecName: Full=Histone H3.2 sp|Q6LCK1.3|H32_BRANA RecName: Full=Histone H3.2 sp|Q76MV0.1|H32_TOBAC RecName: Full=Histone H3.2 sp|Q2RAD9.1|H32_ORYSJ RecName: Full=Histone H3.2 sp|A2Y533.1|H32_ORYSI RecName: Full=Histone H3.2 gb|AAF64452.1|AF239930_1 histone H3 [Euphorbia esula] gb|AAK49583.1|AF370577_1 histone H3 [Arabidopsis thaliana] emb|CAA31969.1| unnamed protein product [Oryza sativa] emb|CAA31970.1| unnamed protein product [Oryza sativa] gb|AAA33471.1| histone H3 (H3C3) [Zea mays] gb|AAA33472.1| histone H3 [Zea mays] gb|AAA33473.1| histone H3 [Zea mays] gb|AAA66265.1| histone H3 [Zea mays] gb|AAA33852.1| histone H3 [Petroselinum crispum] gb|AAA33853.1| histone H3 [Petroselinum crispum] gb|AAA33854.1| histone H3 [Petroselinum crispum] gb|AAA32808.1| histone H3 [Arabidopsis thaliana] gb|AAA32809.1| histone H3 [Arabidopsis thaliana] emb|CAA59111.1| histone 3 [Zea mays] gb|AAA79889.1| histone H3 [Arabidopsis thaliana] gb|AAB67837.1| histone H3 homolog [Brassica napus] emb|CAA57811.1| Histone H3 [Asparagus officinalis] gb|AAB18816.1| histone 3 [Oryza sativa Indica Group] gb|AAC24084.1| Match to histone H3 gene gb|M17131 and gb|M35387 from A. thaliana. ESTs gb|H76511 gb|H76255, gb|AA712452, gb|N65260 and gb|T42306 come from this gene [Arabidopsis thaliana] dbj|BAA81840.1| histone H3 [Oryza sativa Japonica Group] dbj|BAA81841.1| histone H3 [Oryza sativa Japonica Group] emb|CAB89403.1| histone H3-like protein [Arabidopsis thaliana] emb|CAB89404.1| histone H3-like protein [Arabidopsis thaliana] dbj|BAA95712.1| histone H3-like protein [Arabidopsis thaliana] dbj|BAB11558.1| histone H3 [Arabidopsis thaliana] gb|AAK59851.1| AT3g27360/K1G2_6 [Arabidopsis thaliana] gb|AAK64008.1| AT5g65360/MNA5_9 [Arabidopsis thaliana] gb|AAL76132.1| AT3g27360/K1G2_6 [Arabidopsis thaliana] gb|AAL87394.1| AT5g65360/MNA5_9 [Arabidopsis thaliana] gb|AAM60903.1| histone H3-like protein [Arabidopsis thaliana] dbj|BAC01212.1| histone H3 [Oryza sativa Japonica Group] gb|AAM95675.1| histone H3 [Orobanche cernua var. cumana] dbj|BAC41835.1| putative histone H3 [Arabidopsis thaliana] dbj|BAC53942.1| H3 histone [Nicotiana tabacum] gb|AAO23616.1| At5g10400 [Arabidopsis thaliana] gb|AAO24594.1| At1g09200 [Arabidopsis thaliana] gb|AAO64207.1| putative histone H3 [Arabidopsis thaliana] gb|AAP04053.1| putative histone H3 [Arabidopsis thaliana] emb|CAE02924.1| OSJNBb0108J11.17 [Oryza sativa Japonica Group] gb|AAT07615.1| putative histone H3 [Oryza sativa Japonica Group] dbj|BAD46448.1| histone H3 [Oryza sativa Japonica Group] dbj|BAD46453.1| histone H3 [Oryza sativa Japonica Group] dbj|BAD46454.1| histone H3 [Oryza sativa Japonica Group] gb|AAX92719.1| histone H3 - maize [Oryza sativa Japonica Group] gb|AAZ66939.1| 117M18_20 [Brassica rapa] gb|ABA91537.2| Histone H3, putative, expressed [Oryza sativa Japonica Group] dbj|BAF00340.1| histone H3 like protein [Arabidopsis thaliana] dbj|BAE99603.1| histone H3 like protein [Arabidopsis thaliana] dbj|BAE99643.1| histone H3 like protein [Arabidopsis thaliana] dbj|BAF06818.1| Os01g0866200 [Oryza sativa Japonica Group] dbj|BAF14690.1| Os04g0419600 [Oryza sativa Japonica Group] dbj|BAF17574.1| Os05g0438700 [Oryza sativa Japonica Group] dbj|BAF18791.1| Os06g0160100 [Oryza sativa Japonica Group] dbj|BAF27636.1| Os11g0155900 [Oryza sativa Japonica Group] gb|ABK21761.1| unknown [Picea sitchensis] gb|ABK25492.1| unknown [Picea sitchensis] gb|ABK92858.1| unknown [Populus trichocarpa] gb|ABK93905.1| unknown [Populus trichocarpa] gb|ABK93950.1| unknown [Populus trichocarpa] gb|ABK95888.1| unknown [Populus trichocarpa] gb|EAY80005.1| hypothetical protein OsI_35174 [Oryza sativa Indica Group] gb|EAY98193.1| hypothetical protein OsI_20106 [Oryza sativa Indica Group] gb|EAY99776.1| hypothetical protein OsI_21763 [Oryza sativa Indica Group] gb|EAY99779.1| hypothetical protein OsI_21766 [Oryza sativa Indica Group] gb|EAZ14271.1| hypothetical protein OsJ_04197 [Oryza sativa Japonica Group] gb|EAZ30723.1| hypothetical protein OsJ_14783 [Oryza sativa Japonica Group] gb|EAZ35903.1| hypothetical protein OsJ_20204 [Oryza sativa Japonica Group] emb|CAN73758.1| hypothetical protein VITISV_031197 [Vitis vinifera] emb|CAN80002.1| hypothetical protein VITISV_043973 [Vitis vinifera] emb|CAN83843.1| hypothetical protein VITISV_044079 [Vitis vinifera] emb|CAN80880.1| hypothetical protein VITISV_018649 [Vitis vinifera] emb|CAN83194.1| hypothetical protein VITISV_010341 [Vitis vinifera] gb|ABS11143.1| histone H3 [Nicotiana benthamiana] dbj|BAF76800.1| histone H3.1 [Nicotiana tabacum] gb|ACF79612.1| unknown [Zea mays] gb|ACF82232.1| unknown [Zea mays] gb|ACF86247.1| unknown [Zea mays] gb|ACF88431.1| unknown [Zea mays] gb|ACG25137.1| histone H3 [Zea mays] gb|ACG27345.1| histone H3 [Zea mays] gb|ACG30057.1| histone H3 [Zea mays] gb|ACG30474.1| histone H3 [Zea mays] gb|ACG30701.1| histone H3 [Zea mays] gb|ACG30707.1| histone H3 [Zea mays] gb|ACG30791.1| histone H3 [Zea mays] gb|ACG30950.1| histone H3 [Zea mays] gb|ACG31934.1| histone H3 [Zea mays] gb|ACG36961.1| histone H3 [Zea mays] gb|ACG39635.1| histone H3 [Zea mays] gb|ACG40073.1| histone H3 [Zea mays] gb|ACG40983.1| histone H3 [Zea mays] gb|ACG47284.1| histone H3 [Zea mays] gb|ACG70966.1| histone H3 [Ziziphus jujuba] dbj|BAH00243.1| unnamed protein product [Oryza sativa Japonica Group] gb|EEC80059.1| hypothetical protein OsI_21765 [Oryza sativa Indica Group] gb|EEE51672.1| hypothetical protein OsJ_33018 [Oryza sativa Japonica Group] gb|EEF28815.1| histone h3, putative [Ricinus communis] gb|EEF28818.1| histone h3, putative [Ricinus communis] gb|EEF28820.1| histone h3, putative [Ricinus communis] gb|EEF28821.1| histone h3, putative [Ricinus communis] gb|EEF37755.1| histone h3, putative [Ricinus communis] gb|EEF39802.1| histone h3, putative [Ricinus communis] gb|ACN33923.1| unknown [Zea mays] gb|ACR37182.1| unknown [Zea mays] gb|ACR37485.1| unknown [Zea mays] gb|ACR37603.1| unknown [Zea mays] gb|ACR37986.1| unknown [Zea mays] gb|ACR38054.1| unknown [Zea mays] gb|EER87889.1| hypothetical protein SORBI_3010G047200 [Sorghum bicolor] gb|EER89236.1| hypothetical protein SORBI_3010G047100 [Sorghum bicolor] gb|EES05210.1| hypothetical protein SORBI_3004G170500 [Sorghum bicolor] gb|EES10786.1| hypothetical protein SORBI_3006G076400 [Sorghum bicolor] gb|EES12174.1| hypothetical protein SORBI_3006G081800 [Sorghum bicolor] dbj|BAH93339.1| Os06g0159501 [Oryza sativa Japonica Group] dbj|BAH93341.1| Os06g0160001 [Oryza sativa Japonica Group] gb|ADC54261.1| histone H3 [Oryza sativa Japonica Group] gb|ADE76159.1| unknown [Picea sitchensis] gb|ADE76345.1| unknown [Picea sitchensis] gb|ADE76464.1| unknown [Picea sitchensis] gb|ADE77414.1| unknown [Picea sitchensis] gb|EFH49713.1| histone H3 [Arabidopsis lyrata subsp. lyrata] gb|EFH49714.1| histone H3 [Arabidopsis lyrata subsp. lyrata] gb|EFH53304.1| histone H3 [Arabidopsis lyrata subsp. lyrata] gb|EFH68749.1| histone H3 [Arabidopsis lyrata subsp. lyrata] gb|EFH70907.1| histone H3 [Arabidopsis lyrata subsp. lyrata] gb|ADR30794.1| histone H3.1 [Hevea brasiliensis] dbj|BAJ53177.1| JHL18I08.11 [Jatropha curcas] gb|AED91535.1| Histone superfamily protein [Arabidopsis thaliana] gb|AED91536.1| Histone superfamily protein [Arabidopsis thaliana] gb|AED98043.1| Histone superfamily protein [Arabidopsis thaliana] gb|AEE28413.1| Histone superfamily protein [Arabidopsis thaliana] gb|AEE77308.1| Histone superfamily protein [Arabidopsis thaliana] emb|CCD74495.1| histone H3 [Arabidopsis halleri subsp. halleri] gb|EOA22021.1| hypothetical protein CARUB_v10002544mg [Capsella rubella] gb|EOA22699.1| hypothetical protein CARUB_v10003405mg [Capsella rubella] gb|EOA25431.1| hypothetical protein CARUB_v10018763mg [Capsella rubella] gb|EOA37535.1| hypothetical protein CARUB_v10011755mg [Capsella rubella] gb|EOX91995.1| Histone superfamily protein [Theobroma cacao] gb|EOY32556.1| Histone superfamily protein [Theobroma cacao] gb|EPS69903.1| hypothetical protein M569_04854 [Genlisea aurea] gb|ERM95023.1| hypothetical protein AMTR_s00009p00240080 [Amborella trichopoda] gb|ERN16002.1| hypothetical protein AMTR_s00030p00044250 [Amborella trichopoda] gb|ESQ31330.1| hypothetical protein EUTSA_v10005111mg [Eutrema salsugineum] gb|ESQ31480.1| hypothetical protein EUTSA_v10005114mg [Eutrema salsugineum] gb|ESQ38364.1| hypothetical protein EUTSA_v10029057mg [Eutrema salsugineum] gb|ESQ40985.1| hypothetical protein EUTSA_v10014986mg [Eutrema salsugineum] gb|ESQ40987.1| hypothetical protein EUTSA_v10014985mg [Eutrema salsugineum] gb|ESR39550.1| hypothetical protein CICLE_v10026742mg [Citrus clementina] gb|ESR59247.1| hypothetical protein CICLE_v10017132mg [Citrus clementina] gb|ESR59252.1| hypothetical protein CICLE_v10017131mg [Citrus clementina] gb|ESR59267.1| hypothetical protein CICLE_v10017133mg [Citrus clementina] gb|EXB28981.1| Histone [Morus notabilis] gb|EXB28982.1| Histone [Morus notabilis] gb|EXB48389.1| Histone [Morus notabilis] gb|EXB48391.1| Histone [Morus notabilis] gb|EXC30548.1| Histone [Morus notabilis] gb|EYU18019.1| hypothetical protein MIMGU_mgv1a016053mg [Erythranthe guttata] gb|EYU18357.1| hypothetical protein MIMGU_mgv1a016039mg [Erythranthe guttata] gb|EYU26936.1| hypothetical protein MIMGU_mgv1a016046mg [Erythranthe guttata] gb|EYU39090.1| hypothetical protein MIMGU_mgv1a016037mg [Erythranthe guttata] gb|EYU43364.1| hypothetical protein MIMGU_mgv1a024982mg [Erythranthe guttata] gb|EYU46298.1| hypothetical protein MIMGU_mgv1a016044mg [Erythranthe guttata] gb|KCW52687.1| hypothetical protein EUGRSUZ_J02055 [Eucalyptus grandis] gb|KCW87138.1| hypothetical protein EUGRSUZ_B03665 [Eucalyptus grandis] gb|KDO60645.1| hypothetical protein CISIN_1g032664mg [Citrus sinensis] gb|KDO64858.1| hypothetical protein CISIN_1g032661mg [Citrus sinensis] gb|KDO64866.1| hypothetical protein CISIN_1g032673mg [Citrus sinensis] gb|KDO64873.1| hypothetical protein CISIN_1g032676mg [Citrus sinensis] gb|KDP20190.1| hypothetical protein JCGZ_07910 [Jatropha curcas] gb|KDP21024.1| hypothetical protein JCGZ_21495 [Jatropha curcas] emb|CDP11387.1| unnamed protein product [Coffea canephora] emb|CDP07721.1| unnamed protein product [Coffea canephora] emb|CDP07722.1| unnamed protein product [Coffea canephora] gb|KFK25331.1| hypothetical protein AALP_AA8G099000 [Arabis alpina] gb|KFK25332.1| hypothetical protein AALP_AA8G099100 [Arabis alpina] gb|KFK28215.1| hypothetical protein AALP_AA8G487700 [Arabis alpina] gb|KFK28217.1| hypothetical protein AALP_AA8G487900 [Arabis alpina] gb|KFK43216.1| hypothetical protein AALP_AA1G095700 [Arabis alpina] gb|KGN54155.1| histone H3 [Cucumis sativus] gb|AIZ04726.1| histone 3 [Elettaria cardamomum] gb|KJB21399.1| hypothetical protein B456_004G040400 [Gossypium raimondii] gb|KJB21400.1| hypothetical protein B456_004G040400 [Gossypium raimondii] gb|KJB27088.1| hypothetical protein B456_004G277200 [Gossypium raimondii] gb|KJB54045.1| hypothetical protein B456_009G018200 [Gossypium raimondii] gb|KJB70057.1| hypothetical protein B456_011G056400 [Gossypium raimondii] gb|KJB70058.1| hypothetical protein B456_011G056400 [Gossypium raimondii] gb|KJB70059.1| hypothetical protein B456_011G056500 [Gossypium raimondii] gb|KJB83503.1| hypothetical protein B456_013G250500 [Gossypium raimondii] gb|KMT13094.1| hypothetical protein BVRB_4g086350 [Beta vulgaris subsp. vulgaris] gb|KMT13099.1| hypothetical protein BVRB_4g086410 [Beta vulgaris subsp. vulgaris] gb|KMT13100.1| hypothetical protein BVRB_4g086420 [Beta vulgaris subsp. vulgaris] gb|KMT14440.1| hypothetical protein BVRB_4g072160 [Beta vulgaris subsp. vulgaris] gb|KMT14442.1| hypothetical protein BVRB_4g072180 [Beta vulgaris subsp. vulgaris] gb|KNA08063.1| hypothetical protein SOVF_166110 [Spinacia oleracea] gb|KNA10491.1| hypothetical protein SOVF_143550 [Spinacia oleracea] gb|KNA19691.1| hypothetical protein SOVF_059220 [Spinacia oleracea] gb|KNA24957.1| hypothetical protein SOVF_010940 [Spinacia oleracea] gb|KNA25425.1| hypothetical protein SOVF_005400 [Spinacia oleracea] gb|KNA26076.1| hypothetical protein SOVF_000590 [Spinacia oleracea] dbj|BAS96275.1| Os06g0160001 [Oryza sativa Japonica Group] dbj|BAT12754.1| Os11g0155900 [Oryza sativa Japonica Group] gb|KQL09665.1| hypothetical protein SETIT_007481mg [Setaria italica] gb|KQL09668.1| hypothetical protein SETIT_008119mg [Setaria italica] gb|KQL15301.1| hypothetical protein SETIT_023606mg [Setaria italica] gb|ALY11031.1| histone h3 [Ziziphus jujuba] gb|KVH91569.1| Histone core [Cynara cardunculus var. scolymus] gb|KVI09448.1| Histone core [Cynara cardunculus var. scolymus] gb|KZN09387.1| hypothetical protein DCAR_002043 [Daucus carota subsp. sativus] gb|KZV18472.1| hypothetical protein F511_18040 [Dorcoceras hygrometricum] gb|KZV44364.1| hypothetical protein F511_26446 [Dorcoceras hygrometricum] gb|KZV49603.1| hypothetical protein F511_23983 [Dorcoceras hygrometricum] gb|KZV57557.1| hypothetical protein F511_03017 [Dorcoceras hygrometricum] gb|OAO92781.1| hypothetical protein AXX17_AT5G10060 [Arabidopsis thaliana] gb|OAO93749.1| hypothetical protein AXX17_AT5G65170 [Arabidopsis thaliana] gb|OAO95383.1| hypothetical protein AXX17_AT5G10050 [Arabidopsis thaliana] gb|OAP05420.1| hypothetical protein AXX17_AT3G29860 [Arabidopsis thaliana] gb|OAP16403.1| hypothetical protein AXX17_AT1G09060 [Arabidopsis thaliana] gb|OAY22690.1| hypothetical protein MANES_18G018500 [Manihot esculenta] gb|OAY22691.1| hypothetical protein MANES_18G018600 [Manihot esculenta] gb|OAY26256.1| hypothetical protein MANES_16G033300 [Manihot esculenta] gb|OAY26257.1| hypothetical protein MANES_16G033400 [Manihot esculenta] gb|OAY30213.1| hypothetical protein MANES_14G013600 [Manihot esculenta] gb|OAY33453.1| hypothetical protein MANES_13G097500 [Manihot esculenta] gb|OAY33454.1| hypothetical protein MANES_13G097600 [Manihot esculenta] gb|OAY35771.1| hypothetical protein MANES_12G129100 [Manihot esculenta] gb|OAY48573.1| hypothetical protein MANES_06G168000 [Manihot esculenta] gb|OAY76534.1| histone H3.2 [Ananas comosus] gb|OAY84850.1| histone H3.2 [Ananas comosus] gb|OEL28075.1| histone H3.2 [Dichanthelium oligosanthes] gb|OEL37560.1| histone H3.2 [Dichanthelium oligosanthes] gb|OIT01611.1| histone h3.2 [Nicotiana attenuata] gb|OIT06005.1| histone h3.2 [Nicotiana attenuata] gb|OIT19610.1| histone h3.2 [Nicotiana attenuata] gb|OIT29440.1| histone h3.2 [Nicotiana attenuata] gb|OIT33820.1| histone h3.2 [Nicotiana attenuata] gb|OIT33823.1| histone h3.2 [Nicotiana attenuata] gb|OIT34440.1| histone h3.2 [Nicotiana attenuata] gb|OIT35721.1| histone h3.2 [Nicotiana attenuata] gb|OMO56171.1| histone H3 [Corchorus capsularis] gb|OMO61394.1| histone H3 [Corchorus capsularis] gb|OMO68602.1| histone H3 [Corchorus capsularis] gb|OMO73020.1| histone H3 [Corchorus olitorius] gb|OMO75026.1| histone H3 [Corchorus olitorius] gb|OMO78124.1| histone H3 [Corchorus olitorius] gb|OMO79345.1| histone H3 [Corchorus capsularis] gb|OMP07230.1| histone H3 [Corchorus olitorius] gb|ONH99186.1| hypothetical protein PRUPE_6G016200 [Prunus persica] gb|ONH99252.1| hypothetical protein PRUPE_6G021100 [Prunus persica] gb|ONH99260.1| hypothetical protein PRUPE_6G021700 [Prunus persica] gb|ONI10569.1| hypothetical protein PRUPE_4G054300 [Prunus persica] gb|AQK43642.1| Histone H3.2 [Zea mays] gb|AQK43643.1| Histone H3.2 [Zea mays] gb|AQK43644.1| Histone H3.2 [Zea mays] gb|AQK43690.1| Histone H3.2 [Zea mays] gb|ONM17576.1| Histone H3.2 [Zea mays] gb|ONM17641.1| Histone H3.2 [Zea mays] gb|ONM29953.1| Histone H3.2 [Zea mays] gb|ONM33459.1| Histone H3.2 [Zea mays] gb|AQK52929.1| Histone H3.2 [Zea mays] gb|AQK80506.1| Histone H3-like 5 [Zea mays] gb|AQL01931.1| Histone H3.2 [Zea mays] gb|OQU85091.1| hypothetical protein SORBI_3004G170500 [Sorghum bicolor] dbj|BAX24621.1| Histone H3.2 [Oryza sativa Indica Group] dbj|BAX24623.1| Histone H3.2 [Oryza sativa Indica Group] dbj|BAX24624.1| Histone H3.2 [Oryza sativa Indica Group] dbj|BAX24935.1| histone H3 [Oryza punctata] dbj|BAX24937.1| histone H3 [Oryza punctata] dbj|BAX24938.1| histone H3 [Oryza punctata] dbj|BAX25133.1| Histone H3.2 [Oryza brachyantha] dbj|BAX25134.1| Histone H3.2 [Oryza brachyantha] gb|OVA00004.1| histone H3 [Macleaya cordata] gb|OVA04815.1| histone H3 [Macleaya cordata] gb|OWM68807.1| hypothetical protein CDL15_Pgr024994 [Punica granatum] gb|OWM69218.1| hypothetical protein CDL15_Pgr025405 [Punica granatum] gb|OWM76391.1| hypothetical protein CDL15_Pgr028261 [Punica granatum] gb|PAN06389.1| hypothetical protein PAHAL_A02058 [Panicum hallii] gb|PAN25684.1| hypothetical protein PAHAL_J00098 [Panicum hallii] gb|PAN32327.1| hypothetical protein PAHAL_E04027 [Panicum hallii] gb|PAN38095.1| hypothetical protein PAHAL_G00148 [Panicum hallii] gb|PAN38097.1| hypothetical protein PAHAL_G00150 [Panicum hallii] gb|PHT55884.1| histone H3.2 [Capsicum baccatum] gb|PHT59866.1| histone H3.2 [Capsicum baccatum] gb|PHT60180.1| histone H3.2 [Capsicum baccatum] gb|PHT60183.1| histone H3.2 [Capsicum baccatum] gb|PHT60202.1| histone H3.2 [Capsicum baccatum] gb|PHT89981.1| histone H3.2 [Capsicum annuum] gb|PHT93565.1| histone H3.2 [Capsicum annuum] gb|PHT94495.1| histone H3.2 [Capsicum annuum] gb|PHT94599.1| histone H3.2 [Capsicum annuum] gb|PHT94617.1| histone H3.2 [Capsicum annuum] gb|PHT94998.1| histone H3.2 [Capsicum annuum] gb|PHU26249.1| histone H3.2 [Capsicum chinense] gb|PHU30145.1| histone H3.2 [Capsicum chinense] gb|PHU30150.1| histone H3.2 [Capsicum chinense] gb|PHU30441.1| histone H3.2 [Capsicum chinense] gb|PHU30445.1| histone H3.2 [Capsicum chinense] gb|PHU30655.1| histone H3.2 [Capsicum chinense] gb|PIA35068.1| hypothetical protein AQUCO_03600018v1 [Aquilegia coerulea] gb|PIA35088.1| hypothetical protein AQUCO_03600030v1 [Aquilegia coerulea] gb|PIA54070.1| hypothetical protein AQUCO_00900562v1 [Aquilegia coerulea] gb|PIN00176.1| Histones H3 and H4 [Handroanthus impetiginosus] gb|PIN17664.1| Histones H3 and H4 [Handroanthus impetiginosus] gb|PIN18957.1| Histones H3 and H4 [Handroanthus impetiginosus] gb|PIN23817.1| Histones H3 and H4 [Handroanthus impetiginosus] gb|PKA58246.1| Histone H3.2 [Apostasia shenzhenica] gb|PKA58336.1| Histone H3.2 [Apostasia shenzhenica] gb|PKA58338.1| Histone H3.2 [Apostasia shenzhenica] gb|PKI36434.1| hypothetical protein CRG98_043216 [Punica granatum] gb|PKI37978.1| hypothetical protein CRG98_041633 [Punica granatum] gb|PKI58611.1| hypothetical protein CRG98_021000 [Punica granatum] gb|PKI60221.1| hypothetical protein CRG98_019409 [Punica granatum] gb|PKI72834.1| hypothetical protein CRG98_006759 [Punica granatum] dbj|GAY41411.1| hypothetical protein CUMW_059240 [Citrus unshiu] dbj|GAY41424.1| hypothetical protein CUMW_059340 [Citrus unshiu] dbj|GAY41431.1| hypothetical protein CUMW_059400 [Citrus unshiu] gb|PNT03936.1| hypothetical protein POPTR_014G096900v3 [Populus trichocarpa] gb|PNT46712.1| hypothetical protein POPTR_003G207700v3 [Populus trichocarpa] gb|PNT46737.1| hypothetical protein POPTR_003G210100v3 [Populus trichocarpa] gb|PNT47495.1| hypothetical protein POPTR_002G028800v3 [Populus trichocarpa] gb|PNT52171.1| hypothetical protein POPTR_001G016900v3 [Populus trichocarpa] gb|POF05507.1| histone H3.2 [Quercus suber] gb|POF15746.1| histone H3.2 [Quercus suber] gb|POF15748.1| histone H3.2 [Quercus suber] gb|POF15749.1| histone H3.2 [Quercus suber] gb|PON52626.1| histone H3/CENP-A [Parasponia andersonii] gb|PON57118.1| histone H3/CENP-A [Trema orientalis] gb|PON69749.1| histone H3/CENP-A [Parasponia andersonii] gb|PON77941.1| histone H3/CENP-A [Parasponia andersonii] gb|PON89236.1| histone H3/CENP-A [Trema orientalis] gb|PPD67719.1| hypothetical protein GOBAR_DD35399 [Gossypium barbadense] gb|PPD75573.1| hypothetical protein GOBAR_DD27502 [Gossypium barbadense] gb|PPD83470.1| hypothetical protein GOBAR_DD19595 [Gossypium barbadense] gb|PPD84531.1| hypothetical protein GOBAR_DD18540 [Gossypium barbadense] gb|PPD86084.1| hypothetical protein GOBAR_DD16981 [Gossypium barbadense] gb|PPD86085.1| hypothetical protein GOBAR_DD16982 [Gossypium barbadense] gb|PPD86086.1| hypothetical protein GOBAR_DD16983 [Gossypium barbadense] gb|PPE01028.1| hypothetical protein GOBAR_DD01992 [Gossypium barbadense] gb|PPR88551.1| hypothetical protein GOBAR_AA32127 [Gossypium barbadense] gb|PPR88727.1| hypothetical protein GOBAR_AA31968 [Gossypium barbadense] gb|PPR88728.1| hypothetical protein GOBAR_AA31969 [Gossypium barbadense] gb|PPR90211.1| hypothetical protein GOBAR_AA30467 [Gossypium barbadense] gb|PPR94006.1| hypothetical protein GOBAR_AA26667 [Gossypium barbadense] gb|PPS13282.1| hypothetical protein GOBAR_AA07369 [Gossypium barbadense] gb|PPS15042.1| hypothetical protein GOBAR_AA05521 [Gossypium barbadense] gb|PPS15043.1| hypothetical protein GOBAR_AA05522 [Gossypium barbadense] gb|PPS15044.1| hypothetical protein GOBAR_AA05523 [Gossypium barbadense] gb|PPS15045.1| hypothetical protein GOBAR_AA05524 [Gossypium barbadense] gb|PPS15046.1| hypothetical protein GOBAR_AA05525 [Gossypium barbadense] gb|PRQ29035.1| putative transcription factor Hap3/NF-YB family [Rosa chinensis] gb|PRQ33958.1| putative transcription factor Hap3/NF-YB family [Rosa chinensis] gb|PRQ34585.1| putative transcription factor Hap3/NF-YB family [Rosa chinensis] gb|PRQ35225.1| putative transcription factor Hap3/NF-YB family [Rosa chinensis] gb|PRQ35229.1| putative transcription factor Hap3/NF-YB family [Rosa chinensis] gb|PRQ35234.1| putative transcription factor Hap3/NF-YB family [Rosa chinensis] gb|PRQ35241.1| putative transcription factor Hap3/NF-YB family [Rosa chinensis] gb|PRQ52810.1| putative transcription factor Hap3/NF-YB family [Rosa chinensis] prf||1303352A histone H3 prf||1314298B histone H3 Length = 136 Score = 260 bits (665), Expect = 4e-87 Identities = 134/135 (99%), Positives = 135/135 (100%) Frame = -3 Query: 511 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 332 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL Sbjct: 2 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 61 Query: 331 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 152 LIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIHAKRVTIM Sbjct: 62 LIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 121 Query: 151 PKDIQLARRIRGERA 107 PKDIQLARRIRGERA Sbjct: 122 PKDIQLARRIRGERA 136 >emb|CBH32561.1| histone H3, expressed [Triticum aestivum] dbj|BAJ89751.1| predicted protein [Hordeum vulgare subsp. vulgare] dbj|BAK01873.1| predicted protein [Hordeum vulgare subsp. vulgare] dbj|BAK06522.1| predicted protein [Hordeum vulgare subsp. vulgare] dbj|BAJ88326.1| predicted protein [Hordeum vulgare subsp. vulgare] dbj|BAK07409.1| predicted protein [Hordeum vulgare subsp. vulgare] dbj|BAK04782.1| predicted protein [Hordeum vulgare subsp. vulgare] dbj|BAK05326.1| predicted protein [Hordeum vulgare subsp. vulgare] emb|CDM85134.1| unnamed protein product [Triticum aestivum] Length = 136 Score = 260 bits (665), Expect = 4e-87 Identities = 134/135 (99%), Positives = 135/135 (100%) Frame = -3 Query: 511 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 332 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL Sbjct: 2 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 61 Query: 331 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 152 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAE+YLVGLFEDTNLCAIHAKRVTIM Sbjct: 62 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAESYLVGLFEDTNLCAIHAKRVTIM 121 Query: 151 PKDIQLARRIRGERA 107 PKDIQLARRIRGERA Sbjct: 122 PKDIQLARRIRGERA 136 >gb|PIA53463.1| hypothetical protein AQUCO_00900211v1, partial [Aquilegia coerulea] Length = 141 Score = 260 bits (665), Expect = 4e-87 Identities = 134/135 (99%), Positives = 135/135 (100%) Frame = -3 Query: 511 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 332 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL Sbjct: 7 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 66 Query: 331 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 152 LIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIHAKRVTIM Sbjct: 67 LIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 126 Query: 151 PKDIQLARRIRGERA 107 PKDIQLARRIRGERA Sbjct: 127 PKDIQLARRIRGERA 141 >ref|XP_017621393.1| PREDICTED: histone H3.2-like [Gossypium arboreum] Length = 136 Score = 260 bits (664), Expect = 5e-87 Identities = 133/135 (98%), Positives = 135/135 (100%) Frame = -3 Query: 511 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 332 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL Sbjct: 2 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 61 Query: 331 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 152 LIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIHAKRVTIM Sbjct: 62 LIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 121 Query: 151 PKDIQLARRIRGERA 107 PKD+QLARRIRGERA Sbjct: 122 PKDVQLARRIRGERA 136 >gb|AAA32655.1| histone H3 (H3-1.1) [Medicago sativa] Length = 136 Score = 260 bits (664), Expect = 5e-87 Identities = 134/135 (99%), Positives = 134/135 (99%) Frame = -3 Query: 511 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 332 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL Sbjct: 2 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 61 Query: 331 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 152 LIRKLPFQRLVREIAQDFKTDLRFQSS VSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM Sbjct: 62 LIRKLPFQRLVREIAQDFKTDLRFQSSVVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 121 Query: 151 PKDIQLARRIRGERA 107 PKDIQLARRIRGERA Sbjct: 122 PKDIQLARRIRGERA 136 >ref|XP_010260926.1| PREDICTED: histone H3.2-like [Nelumbo nucifera] Length = 136 Score = 260 bits (664), Expect = 5e-87 Identities = 134/135 (99%), Positives = 134/135 (99%) Frame = -3 Query: 511 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 332 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE Sbjct: 2 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEF 61 Query: 331 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 152 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM Sbjct: 62 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 121 Query: 151 PKDIQLARRIRGERA 107 PKDIQLARRIRGERA Sbjct: 122 PKDIQLARRIRGERA 136 >emb|CDP18134.1| unnamed protein product [Coffea canephora] Length = 136 Score = 260 bits (664), Expect = 5e-87 Identities = 133/135 (98%), Positives = 135/135 (100%) Frame = -3 Query: 511 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 332 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL Sbjct: 2 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 61 Query: 331 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 152 LIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIHAKRVT+M Sbjct: 62 LIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTVM 121 Query: 151 PKDIQLARRIRGERA 107 PKDIQLARRIRGERA Sbjct: 122 PKDIQLARRIRGERA 136 >ref|XP_012081631.1| histone H3.2 [Jatropha curcas] gb|KDP29737.1| hypothetical protein JCGZ_18672 [Jatropha curcas] Length = 136 Score = 259 bits (663), Expect = 7e-87 Identities = 133/135 (98%), Positives = 135/135 (100%) Frame = -3 Query: 511 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 332 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL Sbjct: 2 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 61 Query: 331 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 152 LIRKLPFQRLVREIAQDFKTDLRFQSSAV+A+QEAAEAYLVGLFEDTNLCAIHAKRVTIM Sbjct: 62 LIRKLPFQRLVREIAQDFKTDLRFQSSAVAAMQEAAEAYLVGLFEDTNLCAIHAKRVTIM 121 Query: 151 PKDIQLARRIRGERA 107 PKDIQLARRIRGERA Sbjct: 122 PKDIQLARRIRGERA 136 >ref|XP_013631332.1| PREDICTED: histone H3.2-like [Brassica oleracea var. oleracea] Length = 159 Score = 260 bits (665), Expect = 8e-87 Identities = 134/135 (99%), Positives = 135/135 (100%) Frame = -3 Query: 511 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 332 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL Sbjct: 25 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 84 Query: 331 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 152 LIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIHAKRVTIM Sbjct: 85 LIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 144 Query: 151 PKDIQLARRIRGERA 107 PKDIQLARRIRGERA Sbjct: 145 PKDIQLARRIRGERA 159 >gb|KCW51227.1| hypothetical protein EUGRSUZ_J00806, partial [Eucalyptus grandis] Length = 161 Score = 260 bits (665), Expect = 8e-87 Identities = 134/135 (99%), Positives = 135/135 (100%) Frame = -3 Query: 511 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 332 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL Sbjct: 27 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 86 Query: 331 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 152 LIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIHAKRVTIM Sbjct: 87 LIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 146 Query: 151 PKDIQLARRIRGERA 107 PKDIQLARRIRGERA Sbjct: 147 PKDIQLARRIRGERA 161 >ref|XP_009393405.2| PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis] Length = 163 Score = 260 bits (665), Expect = 9e-87 Identities = 134/135 (99%), Positives = 135/135 (100%) Frame = -3 Query: 511 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 332 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL Sbjct: 29 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 88 Query: 331 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 152 LIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIHAKRVTIM Sbjct: 89 LIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 148 Query: 151 PKDIQLARRIRGERA 107 PKDIQLARRIRGERA Sbjct: 149 PKDIQLARRIRGERA 163 >gb|PIA53454.1| hypothetical protein AQUCO_00900205v1, partial [Aquilegia coerulea] Length = 164 Score = 260 bits (665), Expect = 9e-87 Identities = 134/135 (99%), Positives = 135/135 (100%) Frame = -3 Query: 511 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 332 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL Sbjct: 30 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 89 Query: 331 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 152 LIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIHAKRVTIM Sbjct: 90 LIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 149 Query: 151 PKDIQLARRIRGERA 107 PKDIQLARRIRGERA Sbjct: 150 PKDIQLARRIRGERA 164 >gb|KQL29950.1| hypothetical protein SETIT_019787mg, partial [Setaria italica] Length = 164 Score = 260 bits (665), Expect = 9e-87 Identities = 134/135 (99%), Positives = 135/135 (100%) Frame = -3 Query: 511 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 332 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL Sbjct: 30 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 89 Query: 331 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 152 LIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIHAKRVTIM Sbjct: 90 LIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 149 Query: 151 PKDIQLARRIRGERA 107 PKDIQLARRIRGERA Sbjct: 150 PKDIQLARRIRGERA 164 >ref|XP_016690064.1| PREDICTED: histone H3.2-like [Gossypium hirsutum] Length = 166 Score = 260 bits (665), Expect = 1e-86 Identities = 134/135 (99%), Positives = 135/135 (100%) Frame = -3 Query: 511 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 332 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL Sbjct: 32 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 91 Query: 331 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 152 LIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIHAKRVTIM Sbjct: 92 LIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 151 Query: 151 PKDIQLARRIRGERA 107 PKDIQLARRIRGERA Sbjct: 152 PKDIQLARRIRGERA 166 >prf||1202289A histone H3 Length = 135 Score = 259 bits (662), Expect = 1e-86 Identities = 133/135 (98%), Positives = 135/135 (100%) Frame = -3 Query: 511 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTEL 332 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIR+YQKSTEL Sbjct: 1 ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRRYQKSTEL 60 Query: 331 LIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 152 LIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEAAEAYLVGLFEDTNLCAIHAKRVTIM Sbjct: 61 LIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 120 Query: 151 PKDIQLARRIRGERA 107 PKDIQLARRIRGERA Sbjct: 121 PKDIQLARRIRGERA 135