BLASTX nr result
ID: Rehmannia30_contig00022277
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00022277 (819 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012847590.1| PREDICTED: uncharacterized protein LOC105967... 57 8e-06 gb|KHG27082.1| uncharacterized protein F383_09465 [Gossypium arb... 57 9e-06 gb|PPS17471.1| hypothetical protein GOBAR_AA03111 [Gossypium bar... 57 9e-06 >ref|XP_012847590.1| PREDICTED: uncharacterized protein LOC105967535 [Erythranthe guttata] gb|EYU28816.1| hypothetical protein MIMGU_mgv1a009714mg [Erythranthe guttata] Length = 333 Score = 57.4 bits (137), Expect = 8e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -2 Query: 803 QGCTILSGDVIIRHLAEELRPDYVVFLVSTV 711 QGCTILSGDVIIRHLAE+LRPDYVVFL + Sbjct: 198 QGCTILSGDVIIRHLAEQLRPDYVVFLTDVL 228 >gb|KHG27082.1| uncharacterized protein F383_09465 [Gossypium arboreum] Length = 372 Score = 57.4 bits (137), Expect = 9e-06 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -2 Query: 815 LTVRQGCTILSGDVIIRHLAEELRPDYVVFLVS 717 L R GCTILSGDVIIRHLAE LRP+YVVFLVS Sbjct: 190 LDERLGCTILSGDVIIRHLAEHLRPEYVVFLVS 222 >gb|PPS17471.1| hypothetical protein GOBAR_AA03111 [Gossypium barbadense] Length = 380 Score = 57.4 bits (137), Expect = 9e-06 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -2 Query: 815 LTVRQGCTILSGDVIIRHLAEELRPDYVVFLVS 717 L R GCTILSGDVIIRHLAE LRP+YVVFLVS Sbjct: 169 LDERLGCTILSGDVIIRHLAEHLRPEYVVFLVS 201