BLASTX nr result
ID: Rehmannia30_contig00022155
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00022155 (663 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020551664.1| pentatricopeptide repeat-containing protein ... 59 3e-06 gb|EYU37881.1| hypothetical protein MIMGU_mgv1a002592mg [Erythra... 57 6e-06 ref|XP_012837131.1| PREDICTED: pentatricopeptide repeat-containi... 57 6e-06 >ref|XP_020551664.1| pentatricopeptide repeat-containing protein MRL1, chloroplastic [Sesamum indicum] ref|XP_020551665.1| pentatricopeptide repeat-containing protein MRL1, chloroplastic [Sesamum indicum] Length = 1190 Score = 58.5 bits (140), Expect = 3e-06 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +2 Query: 560 AMCLRRFQIARAFGEPVLSFTSGQVQLSSKWTSL 661 AMCLRRFQ A GEPVLSFT GQVQL+SKWTSL Sbjct: 927 AMCLRRFQAACTLGEPVLSFTFGQVQLNSKWTSL 960 >gb|EYU37881.1| hypothetical protein MIMGU_mgv1a002592mg [Erythranthe guttata] Length = 656 Score = 57.4 bits (137), Expect = 6e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +2 Query: 563 MCLRRFQIARAFGEPVLSFTSGQVQLSSKWTSL 661 MCLRRFQ A GEPVLSF+SGQVQL+SKWTSL Sbjct: 395 MCLRRFQAACTVGEPVLSFSSGQVQLNSKWTSL 427 >ref|XP_012837131.1| PREDICTED: pentatricopeptide repeat-containing protein MRL1, chloroplastic [Erythranthe guttata] Length = 1102 Score = 57.4 bits (137), Expect = 6e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +2 Query: 563 MCLRRFQIARAFGEPVLSFTSGQVQLSSKWTSL 661 MCLRRFQ A GEPVLSF+SGQVQL+SKWTSL Sbjct: 841 MCLRRFQAACTVGEPVLSFSSGQVQLNSKWTSL 873