BLASTX nr result
ID: Rehmannia30_contig00021965
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00021965 (680 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI08563.1| Nucleotide-binding, alpha-beta plait, partial [Cy... 60 6e-07 >gb|KVI08563.1| Nucleotide-binding, alpha-beta plait, partial [Cynara cardunculus var. scolymus] Length = 751 Score = 60.5 bits (145), Expect = 6e-07 Identities = 34/49 (69%), Positives = 37/49 (75%) Frame = -2 Query: 646 HLNGLTMRKPLEGFFTEESGFPHIEFDKVGNAYGEAVSVFQPFLLFEDE 500 H N LTMRK L GF TEES FP IEF KVGNAYG AVSV++ F+ EDE Sbjct: 262 HTNELTMRKLLHGF-TEESAFPQIEFHKVGNAYG-AVSVYEVFVHCEDE 308