BLASTX nr result
ID: Rehmannia30_contig00021875
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00021875 (814 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIM97846.1| hypothetical protein CDL12_29678 [Handroanthus im... 68 2e-11 ref|XP_012829519.1| PREDICTED: protein LIKE COV 2-like [Erythran... 59 2e-06 ref|XP_011101236.1| protein LIKE COV 2-like [Sesamum indicum] 59 2e-06 >gb|PIM97846.1| hypothetical protein CDL12_29678 [Handroanthus impetiginosus] Length = 54 Score = 67.8 bits (164), Expect = 2e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 1 SNSPRQNDDVEDPVKSPPHSPNNSSTRKVYI 93 SNSPRQNDDVEDP+KSPPHSPNNSSTRKVYI Sbjct: 24 SNSPRQNDDVEDPLKSPPHSPNNSSTRKVYI 54 >ref|XP_012829519.1| PREDICTED: protein LIKE COV 2-like [Erythranthe guttata] gb|EYU17484.1| hypothetical protein MIMGU_mgv1a011803mg [Erythranthe guttata] Length = 270 Score = 58.9 bits (141), Expect = 2e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +1 Query: 4 NSPRQNDDVEDPVKSPPHSPNNSSTRK 84 NSPRQNDDVEDPVKSPPHSPNNSS RK Sbjct: 25 NSPRQNDDVEDPVKSPPHSPNNSSGRK 51 >ref|XP_011101236.1| protein LIKE COV 2-like [Sesamum indicum] Length = 271 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +1 Query: 1 SNSPRQNDDVEDPVKSPPHSPNNSSTRK 84 SNSPRQ+ DVEDPVKSPPHSPNNSSTRK Sbjct: 25 SNSPRQDGDVEDPVKSPPHSPNNSSTRK 52