BLASTX nr result
ID: Rehmannia30_contig00021572
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00021572 (480 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOA22054.1| hypothetical protein CARUB_v10002594mg [Capsella ... 62 2e-09 gb|PPD91946.1| hypothetical protein GOBAR_DD11136 [Gossypium bar... 62 2e-09 ref|XP_022883596.1| AP-2 complex subunit alpha-1-like isoform X2... 65 2e-09 ref|XP_022883594.1| AP-2 complex subunit alpha-1-like isoform X1... 65 2e-09 ref|XP_022854311.1| AP-2 complex subunit alpha-1-like isoform X3... 65 2e-09 ref|XP_022854310.1| AP-2 complex subunit alpha-1-like isoform X2... 65 2e-09 ref|XP_022854309.1| AP-2 complex subunit alpha-1-like isoform X1... 65 2e-09 gb|EPS57461.1| hypothetical protein M569_17356, partial [Genlise... 62 3e-09 ref|XP_019436323.1| PREDICTED: AP-2 complex subunit alpha-1-like... 64 3e-09 ref|XP_006349072.1| PREDICTED: AP-2 complex subunit alpha-1-like... 65 3e-09 ref|XP_006349071.1| PREDICTED: AP-2 complex subunit alpha-1-like... 65 3e-09 ref|XP_015058609.1| PREDICTED: AP-2 complex subunit alpha-1-like... 65 3e-09 ref|XP_010313320.1| PREDICTED: LOW QUALITY PROTEIN: AP-2 complex... 65 3e-09 dbj|GAV89809.1| Adaptin_N domain-containing protein/Alpha_adapti... 64 6e-09 gb|KZV42618.1| AP-2 complex subunit alpha-1 [Dorcoceras hygromet... 64 6e-09 ref|XP_016442622.1| PREDICTED: AP-2 complex subunit alpha-1-like... 64 7e-09 gb|PKI78777.1| hypothetical protein CRG98_000844 [Punica granatum] 64 8e-09 gb|PNT21473.1| hypothetical protein POPTR_009G150300v3 [Populus ... 64 8e-09 gb|PHU03754.1| AP-2 complex subunit alpha-2 [Capsicum chinense] 64 8e-09 ref|XP_021609323.1| AP-2 complex subunit alpha-1-like isoform X3... 64 8e-09 >gb|EOA22054.1| hypothetical protein CARUB_v10002594mg [Capsella rubella] Length = 119 Score = 62.4 bits (150), Expect = 2e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 3 DPADRTQLRMTIASGDPALTFELKEFIKEQLV 98 DPADRTQLRMT+ SGDP+LTFELKEFIKEQL+ Sbjct: 46 DPADRTQLRMTVGSGDPSLTFELKEFIKEQLI 77 >gb|PPD91946.1| hypothetical protein GOBAR_DD11136 [Gossypium barbadense] Length = 120 Score = 62.4 bits (150), Expect = 2e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 3 DPADRTQLRMTIASGDPALTFELKEFIKEQLV 98 DPADRTQLRMT+ASGDP LTFELKEFIKEQL+ Sbjct: 51 DPADRTQLRMTLASGDPTLTFELKEFIKEQLM 82 >ref|XP_022883596.1| AP-2 complex subunit alpha-1-like isoform X2 [Olea europaea var. sylvestris] Length = 1015 Score = 65.5 bits (158), Expect = 2e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 3 DPADRTQLRMTIASGDPALTFELKEFIKEQLV 98 DPADRTQLRMT+ASGDPALTFELKEFIKEQLV Sbjct: 952 DPADRTQLRMTVASGDPALTFELKEFIKEQLV 983 >ref|XP_022883594.1| AP-2 complex subunit alpha-1-like isoform X1 [Olea europaea var. sylvestris] Length = 1017 Score = 65.5 bits (158), Expect = 2e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 3 DPADRTQLRMTIASGDPALTFELKEFIKEQLV 98 DPADRTQLRMT+ASGDPALTFELKEFIKEQLV Sbjct: 954 DPADRTQLRMTVASGDPALTFELKEFIKEQLV 985 >ref|XP_022854311.1| AP-2 complex subunit alpha-1-like isoform X3 [Olea europaea var. sylvestris] Length = 1019 Score = 65.5 bits (158), Expect = 2e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 3 DPADRTQLRMTIASGDPALTFELKEFIKEQLV 98 DPADRTQLRMT+ASGDPALTFELKEFIKEQLV Sbjct: 952 DPADRTQLRMTVASGDPALTFELKEFIKEQLV 983 >ref|XP_022854310.1| AP-2 complex subunit alpha-1-like isoform X2 [Olea europaea var. sylvestris] Length = 1021 Score = 65.5 bits (158), Expect = 2e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 3 DPADRTQLRMTIASGDPALTFELKEFIKEQLV 98 DPADRTQLRMT+ASGDPALTFELKEFIKEQLV Sbjct: 954 DPADRTQLRMTVASGDPALTFELKEFIKEQLV 985 >ref|XP_022854309.1| AP-2 complex subunit alpha-1-like isoform X1 [Olea europaea var. sylvestris] Length = 1050 Score = 65.5 bits (158), Expect = 2e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 3 DPADRTQLRMTIASGDPALTFELKEFIKEQLV 98 DPADRTQLRMT+ASGDPALTFELKEFIKEQLV Sbjct: 983 DPADRTQLRMTVASGDPALTFELKEFIKEQLV 1014 >gb|EPS57461.1| hypothetical protein M569_17356, partial [Genlisea aurea] Length = 129 Score = 62.0 bits (149), Expect = 3e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 3 DPADRTQLRMTIASGDPALTFELKEFIKEQLV 98 DPADRTQLR+T+ASGDP LTFELKEF+KEQLV Sbjct: 57 DPADRTQLRITVASGDPVLTFELKEFVKEQLV 88 >ref|XP_019436323.1| PREDICTED: AP-2 complex subunit alpha-1-like [Lupinus angustifolius] Length = 214 Score = 63.5 bits (153), Expect = 3e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 3 DPADRTQLRMTIASGDPALTFELKEFIKEQLV 98 DPADRTQLRMT+ASGDP LTFELKEFIKEQL+ Sbjct: 143 DPADRTQLRMTVASGDPTLTFELKEFIKEQLI 174 >ref|XP_006349072.1| PREDICTED: AP-2 complex subunit alpha-1-like isoform X1 [Solanum tuberosum] Length = 1019 Score = 65.1 bits (157), Expect = 3e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +3 Query: 3 DPADRTQLRMTIASGDPALTFELKEFIKEQLV 98 DPADRTQLRMT+ASGDPALTFELKEF+KEQLV Sbjct: 952 DPADRTQLRMTVASGDPALTFELKEFVKEQLV 983 >ref|XP_006349071.1| PREDICTED: AP-2 complex subunit alpha-1-like isoform X2 [Solanum tuberosum] Length = 1019 Score = 65.1 bits (157), Expect = 3e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +3 Query: 3 DPADRTQLRMTIASGDPALTFELKEFIKEQLV 98 DPADRTQLRMT+ASGDPALTFELKEF+KEQLV Sbjct: 952 DPADRTQLRMTVASGDPALTFELKEFVKEQLV 983 >ref|XP_015058609.1| PREDICTED: AP-2 complex subunit alpha-1-like [Solanum pennellii] Length = 1020 Score = 65.1 bits (157), Expect = 3e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +3 Query: 3 DPADRTQLRMTIASGDPALTFELKEFIKEQLV 98 DPADRTQLRMT+ASGDPALTFELKEF+KEQLV Sbjct: 952 DPADRTQLRMTVASGDPALTFELKEFVKEQLV 983 >ref|XP_010313320.1| PREDICTED: LOW QUALITY PROTEIN: AP-2 complex subunit alpha-1-like [Solanum lycopersicum] Length = 1020 Score = 65.1 bits (157), Expect = 3e-09 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +3 Query: 3 DPADRTQLRMTIASGDPALTFELKEFIKEQLV 98 DPADRTQLRMT+ASGDPALTFELKEF+KEQLV Sbjct: 952 DPADRTQLRMTVASGDPALTFELKEFVKEQLV 983 >dbj|GAV89809.1| Adaptin_N domain-containing protein/Alpha_adaptin_C domain-containing protein/Alpha_adaptinC2 domain-containing protein [Cephalotus follicularis] Length = 1026 Score = 64.3 bits (155), Expect = 6e-09 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +3 Query: 3 DPADRTQLRMTIASGDPALTFELKEFIKEQLV 98 DPADRTQLRMTIASGDP LTFELKEFIKEQLV Sbjct: 956 DPADRTQLRMTIASGDPTLTFELKEFIKEQLV 987 >gb|KZV42618.1| AP-2 complex subunit alpha-1 [Dorcoceras hygrometricum] Length = 1043 Score = 64.3 bits (155), Expect = 6e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 3 DPADRTQLRMTIASGDPALTFELKEFIKEQLV 98 DPADR+QLRMTIASGDPALTFELKEFIKEQLV Sbjct: 975 DPADRSQLRMTIASGDPALTFELKEFIKEQLV 1006 >ref|XP_016442622.1| PREDICTED: AP-2 complex subunit alpha-1-like, partial [Nicotiana tabacum] Length = 530 Score = 63.9 bits (154), Expect = 7e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 3 DPADRTQLRMTIASGDPALTFELKEFIKEQLV 98 DPADRTQLRMT+ASGDP LTFELKEFIKEQLV Sbjct: 460 DPADRTQLRMTVASGDPTLTFELKEFIKEQLV 491 >gb|PKI78777.1| hypothetical protein CRG98_000844 [Punica granatum] Length = 733 Score = 63.9 bits (154), Expect = 8e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 3 DPADRTQLRMTIASGDPALTFELKEFIKEQLV 98 DPADRTQLRMT+ASGDP LTFELKEFIKEQLV Sbjct: 667 DPADRTQLRMTVASGDPTLTFELKEFIKEQLV 698 >gb|PNT21473.1| hypothetical protein POPTR_009G150300v3 [Populus trichocarpa] Length = 735 Score = 63.9 bits (154), Expect = 8e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 3 DPADRTQLRMTIASGDPALTFELKEFIKEQLV 98 DPADRTQLRMT+ASGDP LTFELKEFIKEQLV Sbjct: 668 DPADRTQLRMTVASGDPTLTFELKEFIKEQLV 699 >gb|PHU03754.1| AP-2 complex subunit alpha-2 [Capsicum chinense] Length = 761 Score = 63.9 bits (154), Expect = 8e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 3 DPADRTQLRMTIASGDPALTFELKEFIKEQLV 98 DPADRTQLRMT+ASGDP LTFELKEFIKEQLV Sbjct: 693 DPADRTQLRMTVASGDPTLTFELKEFIKEQLV 724 >ref|XP_021609323.1| AP-2 complex subunit alpha-1-like isoform X3 [Manihot esculenta] Length = 837 Score = 63.9 bits (154), Expect = 8e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 3 DPADRTQLRMTIASGDPALTFELKEFIKEQLV 98 DPADRTQLRMT+ASGDP LTFELKEFIKEQLV Sbjct: 770 DPADRTQLRMTVASGDPTLTFELKEFIKEQLV 801