BLASTX nr result
ID: Rehmannia30_contig00021567
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00021567 (447 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN18244.1| Ca2+/calmodulin-dependent protein kinase, EF-Hand... 75 6e-13 ref|XP_011085503.1| CDPK-related protein kinase [Sesamum indicum] 74 2e-12 ref|XP_022853654.1| CDPK-related protein kinase isoform X2 [Olea... 74 2e-12 ref|XP_022853653.1| CDPK-related protein kinase isoform X1 [Olea... 74 2e-12 gb|PIN19125.1| Ca2+/calmodulin-dependent protein kinase, EF-Hand... 73 3e-12 ref|XP_012853170.1| PREDICTED: CDPK-related kinase 5 [Erythranth... 72 6e-12 gb|KHN35705.1| CDPK-related protein kinase, partial [Glycine soja] 70 8e-12 ref|XP_022858341.1| CDPK-related kinase 5-like isoform X2 [Olea ... 72 9e-12 ref|XP_022858340.1| CDPK-related kinase 5-like isoform X1 [Olea ... 72 9e-12 gb|KDO79301.1| hypothetical protein CISIN_1g007253mg [Citrus sin... 72 1e-11 gb|ESR39087.1| hypothetical protein CICLE_v10025192mg [Citrus cl... 72 1e-11 ref|XP_009366775.1| PREDICTED: CDPK-related kinase 5-like [Pyrus... 72 1e-11 ref|XP_009366804.1| PREDICTED: CDPK-related kinase 5-like [Pyrus... 72 1e-11 ref|XP_008338287.1| PREDICTED: CDPK-related kinase 5 [Malus dome... 72 1e-11 gb|PKI47473.1| hypothetical protein CRG98_032063 [Punica granatum] 71 1e-11 gb|OWM83747.1| hypothetical protein CDL15_Pgr004177 [Punica gran... 71 2e-11 ref|XP_022896405.1| CDPK-related kinase 5-like [Olea europaea va... 71 2e-11 ref|XP_011099193.1| CDPK-related protein kinase isoform X2 [Sesa... 71 2e-11 ref|XP_011099192.1| CDPK-related kinase 5 isoform X1 [Sesamum in... 71 2e-11 ref|XP_016678875.1| PREDICTED: CDPK-related kinase 5 isoform X2 ... 70 3e-11 >gb|PIN18244.1| Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Handroanthus impetiginosus] Length = 416 Score = 75.1 bits (183), Expect = 6e-13 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 445 HPWIKNTNGVKVPLDILIFKLMKAYMRSSPLRKAALR 335 HPWIKNTN VKVP+DILIFKLMKAYMRSSPLRKAALR Sbjct: 221 HPWIKNTNDVKVPMDILIFKLMKAYMRSSPLRKAALR 257 >ref|XP_011085503.1| CDPK-related protein kinase [Sesamum indicum] Length = 613 Score = 73.9 bits (180), Expect = 2e-12 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -3 Query: 445 HPWIKNTNGVKVPLDILIFKLMKAYMRSSPLRKAALR 335 HPW++NTN VKVPLDILIFKLMKAYMRSSPLRKAALR Sbjct: 418 HPWLRNTNDVKVPLDILIFKLMKAYMRSSPLRKAALR 454 >ref|XP_022853654.1| CDPK-related protein kinase isoform X2 [Olea europaea var. sylvestris] ref|XP_022853655.1| CDPK-related protein kinase isoform X2 [Olea europaea var. sylvestris] Length = 416 Score = 73.6 bits (179), Expect = 2e-12 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -3 Query: 445 HPWIKNTNGVKVPLDILIFKLMKAYMRSSPLRKAALR 335 HPWIKN+N +KVPLDIL+FKLMKAYMRSSPLRKAALR Sbjct: 221 HPWIKNSNDIKVPLDILVFKLMKAYMRSSPLRKAALR 257 >ref|XP_022853653.1| CDPK-related protein kinase isoform X1 [Olea europaea var. sylvestris] Length = 607 Score = 73.6 bits (179), Expect = 2e-12 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = -3 Query: 445 HPWIKNTNGVKVPLDILIFKLMKAYMRSSPLRKAALR 335 HPWIKN+N +KVPLDIL+FKLMKAYMRSSPLRKAALR Sbjct: 412 HPWIKNSNDIKVPLDILVFKLMKAYMRSSPLRKAALR 448 >gb|PIN19125.1| Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Handroanthus impetiginosus] Length = 609 Score = 73.2 bits (178), Expect = 3e-12 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -3 Query: 445 HPWIKNTNGVKVPLDILIFKLMKAYMRSSPLRKAALR 335 HPWI+NTN +KVPLDILIFKLMK YMRSSPLRKAALR Sbjct: 414 HPWIRNTNNIKVPLDILIFKLMKTYMRSSPLRKAALR 450 >ref|XP_012853170.1| PREDICTED: CDPK-related kinase 5 [Erythranthe guttata] gb|EYU44373.1| hypothetical protein MIMGU_mgv1a003006mg [Erythranthe guttata] Length = 616 Score = 72.4 bits (176), Expect = 6e-12 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = -3 Query: 445 HPWIKNTNGVKVPLDILIFKLMKAYMRSSPLRKAALR 335 HPWI+NT+ VKVPLDILIFKLMKAYMRSSPLRKAALR Sbjct: 421 HPWIRNTSEVKVPLDILIFKLMKAYMRSSPLRKAALR 457 >gb|KHN35705.1| CDPK-related protein kinase, partial [Glycine soja] Length = 190 Score = 69.7 bits (169), Expect = 8e-12 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = -3 Query: 445 HPWIKNTNGVKVPLDILIFKLMKAYMRSSPLRKAALRV 332 HPWI+N N VKVPLDILIFKLMK YMRSS LRKAALRV Sbjct: 72 HPWIRNCNNVKVPLDILIFKLMKTYMRSSSLRKAALRV 109 >ref|XP_022858341.1| CDPK-related kinase 5-like isoform X2 [Olea europaea var. sylvestris] Length = 607 Score = 72.0 bits (175), Expect = 9e-12 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -3 Query: 445 HPWIKNTNGVKVPLDILIFKLMKAYMRSSPLRKAALR 335 HPWIKN+N KVPLDIL+FKLMKAYMRSSPLRKAALR Sbjct: 412 HPWIKNSNDYKVPLDILVFKLMKAYMRSSPLRKAALR 448 >ref|XP_022858340.1| CDPK-related kinase 5-like isoform X1 [Olea europaea var. sylvestris] Length = 608 Score = 72.0 bits (175), Expect = 9e-12 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -3 Query: 445 HPWIKNTNGVKVPLDILIFKLMKAYMRSSPLRKAALR 335 HPWIKN+N KVPLDIL+FKLMKAYMRSSPLRKAALR Sbjct: 413 HPWIKNSNDYKVPLDILVFKLMKAYMRSSPLRKAALR 449 >gb|KDO79301.1| hypothetical protein CISIN_1g007253mg [Citrus sinensis] Length = 455 Score = 71.6 bits (174), Expect = 1e-11 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -3 Query: 445 HPWIKNTNGVKVPLDILIFKLMKAYMRSSPLRKAALRV 332 HPWIKN+N VKVPLD++IFKLMKAYMRSS LRKAALRV Sbjct: 416 HPWIKNSNDVKVPLDVIIFKLMKAYMRSSSLRKAALRV 453 >gb|ESR39087.1| hypothetical protein CICLE_v10025192mg [Citrus clementina] Length = 455 Score = 71.6 bits (174), Expect = 1e-11 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -3 Query: 445 HPWIKNTNGVKVPLDILIFKLMKAYMRSSPLRKAALRV 332 HPWIKN+N VKVPLD++IFKLMKAYMRSS LRKAALRV Sbjct: 416 HPWIKNSNDVKVPLDVIIFKLMKAYMRSSSLRKAALRV 453 >ref|XP_009366775.1| PREDICTED: CDPK-related kinase 5-like [Pyrus x bretschneideri] Length = 602 Score = 71.6 bits (174), Expect = 1e-11 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -3 Query: 445 HPWIKNTNGVKVPLDILIFKLMKAYMRSSPLRKAALR 335 HPW+KN+N +KVPLDILIFKLMK YMRSSPLRKAALR Sbjct: 407 HPWLKNSNDIKVPLDILIFKLMKVYMRSSPLRKAALR 443 >ref|XP_009366804.1| PREDICTED: CDPK-related kinase 5-like [Pyrus x bretschneideri] Length = 602 Score = 71.6 bits (174), Expect = 1e-11 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -3 Query: 445 HPWIKNTNGVKVPLDILIFKLMKAYMRSSPLRKAALR 335 HPW+KN+N +KVPLDILIFKLMK YMRSSPLRKAALR Sbjct: 407 HPWLKNSNDIKVPLDILIFKLMKVYMRSSPLRKAALR 443 >ref|XP_008338287.1| PREDICTED: CDPK-related kinase 5 [Malus domestica] Length = 602 Score = 71.6 bits (174), Expect = 1e-11 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -3 Query: 445 HPWIKNTNGVKVPLDILIFKLMKAYMRSSPLRKAALR 335 HPW+KN+N +KVPLDILIFKLMK YMRSSPLRKAALR Sbjct: 407 HPWLKNSNDIKVPLDILIFKLMKVYMRSSPLRKAALR 443 >gb|PKI47473.1| hypothetical protein CRG98_032063 [Punica granatum] Length = 416 Score = 71.2 bits (173), Expect = 1e-11 Identities = 30/37 (81%), Positives = 36/37 (97%) Frame = -3 Query: 445 HPWIKNTNGVKVPLDILIFKLMKAYMRSSPLRKAALR 335 HPW++N NG+K+PLDILIFK+MKAYMRSSPLRKAAL+ Sbjct: 221 HPWLRNYNGIKIPLDILIFKMMKAYMRSSPLRKAALK 257 >gb|OWM83747.1| hypothetical protein CDL15_Pgr004177 [Punica granatum] Length = 584 Score = 71.2 bits (173), Expect = 2e-11 Identities = 30/37 (81%), Positives = 36/37 (97%) Frame = -3 Query: 445 HPWIKNTNGVKVPLDILIFKLMKAYMRSSPLRKAALR 335 HPW++N NG+K+PLDILIFK+MKAYMRSSPLRKAAL+ Sbjct: 389 HPWLRNYNGIKIPLDILIFKMMKAYMRSSPLRKAALK 425 >ref|XP_022896405.1| CDPK-related kinase 5-like [Olea europaea var. sylvestris] Length = 592 Score = 71.2 bits (173), Expect = 2e-11 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -3 Query: 445 HPWIKNTNGVKVPLDILIFKLMKAYMRSSPLRKAALR 335 HPWIKN+N VKVPLDILIFKLMK Y+RSSPLRKAALR Sbjct: 397 HPWIKNSNDVKVPLDILIFKLMKTYIRSSPLRKAALR 433 >ref|XP_011099193.1| CDPK-related protein kinase isoform X2 [Sesamum indicum] Length = 419 Score = 70.9 bits (172), Expect = 2e-11 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -3 Query: 445 HPWIKNTNGVKVPLDILIFKLMKAYMRSSPLRKAALR 335 HPWIK +N VKVPLDILIFKLM+AYMRSSPLRKAALR Sbjct: 224 HPWIKTSNDVKVPLDILIFKLMRAYMRSSPLRKAALR 260 >ref|XP_011099192.1| CDPK-related kinase 5 isoform X1 [Sesamum indicum] Length = 611 Score = 70.9 bits (172), Expect = 2e-11 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -3 Query: 445 HPWIKNTNGVKVPLDILIFKLMKAYMRSSPLRKAALR 335 HPWIK +N VKVPLDILIFKLM+AYMRSSPLRKAALR Sbjct: 416 HPWIKTSNDVKVPLDILIFKLMRAYMRSSPLRKAALR 452 >ref|XP_016678875.1| PREDICTED: CDPK-related kinase 5 isoform X2 [Gossypium hirsutum] Length = 425 Score = 70.5 bits (171), Expect = 3e-11 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = -3 Query: 445 HPWIKNTNGVKVPLDILIFKLMKAYMRSSPLRKAALRV 332 HPWIKN N VKVPLDILIFKLMKAY+RSS LRKAALRV Sbjct: 230 HPWIKNYNDVKVPLDILIFKLMKAYLRSSSLRKAALRV 267