BLASTX nr result
ID: Rehmannia30_contig00021501
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00021501 (615 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012841852.1| PREDICTED: chloride channel protein CLC-f [E... 68 9e-10 >ref|XP_012841852.1| PREDICTED: chloride channel protein CLC-f [Erythranthe guttata] Length = 775 Score = 68.2 bits (165), Expect = 9e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -3 Query: 613 AILYYDSIWNCLRDELNHRKSVKQQIENDSGKIIA 509 AILYYDSIWNCLRDELNHRK + QQIE+DSGKI+A Sbjct: 739 AILYYDSIWNCLRDELNHRKLLSQQIEDDSGKIVA 773