BLASTX nr result
ID: Rehmannia30_contig00021427
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00021427 (403 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28440.1| hypothetical protein MIMGU_mgv1a010928mg [Erythra... 55 3e-06 ref|XP_012848167.1| PREDICTED: uncharacterized protein LOC105968... 55 4e-06 >gb|EYU28440.1| hypothetical protein MIMGU_mgv1a010928mg [Erythranthe guttata] Length = 297 Score = 55.1 bits (131), Expect = 3e-06 Identities = 21/37 (56%), Positives = 32/37 (86%) Frame = +3 Query: 288 GCLRYFHEVELERDCRICTDADSGSYVPPSLGENAEI 398 GCLRY+H+V+ E+DC TDA+ GSY+PP+LGE++++ Sbjct: 143 GCLRYYHQVKPEQDCYNRTDAEGGSYIPPTLGEDSDM 179 >ref|XP_012848167.1| PREDICTED: uncharacterized protein LOC105968097 [Erythranthe guttata] Length = 322 Score = 55.1 bits (131), Expect = 4e-06 Identities = 21/37 (56%), Positives = 32/37 (86%) Frame = +3 Query: 288 GCLRYFHEVELERDCRICTDADSGSYVPPSLGENAEI 398 GCLRY+H+V+ E+DC TDA+ GSY+PP+LGE++++ Sbjct: 128 GCLRYYHQVKPEQDCYNRTDAEGGSYIPPTLGEDSDM 164