BLASTX nr result
ID: Rehmannia30_contig00020970
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00020970 (836 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS60200.1| hypothetical protein M569_14604 [Genlisea aurea] 100 2e-21 ref|XP_022894075.1| nucleobase-ascorbate transporter 6-like [Ole... 101 4e-21 gb|KZV34727.1| nucleobase-ascorbate transporter 6 [Dorcoceras hy... 102 9e-21 ref|XP_011071803.1| nucleobase-ascorbate transporter 6 [Sesamum ... 102 9e-21 ref|XP_022893988.1| nucleobase-ascorbate transporter 6 [Olea eur... 101 1e-20 gb|EYU29931.1| hypothetical protein MIMGU_mgv1a026566mg, partial... 100 1e-20 gb|EPS60302.1| hypothetical protein M569_14502, partial [Genlise... 95 2e-20 ref|XP_016487535.1| PREDICTED: nucleobase-ascorbate transporter ... 95 2e-20 ref|XP_012846286.1| PREDICTED: nucleobase-ascorbate transporter ... 100 2e-20 gb|KZV39691.1| nucleobase-ascorbate transporter 6 [Dorcoceras hy... 100 4e-20 ref|XP_011087158.1| nucleobase-ascorbate transporter 6 [Sesamum ... 100 6e-20 gb|KZV52114.1| nucleobase-ascorbate transporter 6 [Dorcoceras hy... 98 3e-19 ref|XP_019252846.1| PREDICTED: nucleobase-ascorbate transporter ... 97 4e-19 ref|XP_016503856.1| PREDICTED: nucleobase-ascorbate transporter ... 97 4e-19 ref|XP_009608483.1| PREDICTED: nucleobase-ascorbate transporter ... 97 5e-19 ref|XP_016503850.1| PREDICTED: nucleobase-ascorbate transporter ... 97 6e-19 ref|XP_016503849.1| PREDICTED: nucleobase-ascorbate transporter ... 97 6e-19 ref|XP_012831180.1| PREDICTED: nucleobase-ascorbate transporter ... 97 7e-19 ref|XP_022885310.1| nucleobase-ascorbate transporter 6-like [Ole... 96 9e-19 ref|XP_016466374.1| PREDICTED: nucleobase-ascorbate transporter ... 95 1e-18 >gb|EPS60200.1| hypothetical protein M569_14604 [Genlisea aurea] Length = 268 Score = 100 bits (249), Expect = 2e-21 Identities = 50/59 (84%), Positives = 54/59 (91%) Frame = -2 Query: 433 SEEKAQVIQTLLFVAGLNTLLQSWFGTSLAVVIGGSYTFVASIISIILSGRWSDLDPIS 257 +EEKA+VIQTLLFVAGLNTLLQ+WFGT L VVIGGSYTFVA I+IILSGRWSD DPIS Sbjct: 69 NEEKAKVIQTLLFVAGLNTLLQTWFGTRLPVVIGGSYTFVAPTITIILSGRWSDPDPIS 127 >ref|XP_022894075.1| nucleobase-ascorbate transporter 6-like [Olea europaea var. sylvestris] Length = 373 Score = 101 bits (252), Expect = 4e-21 Identities = 51/59 (86%), Positives = 54/59 (91%) Frame = -2 Query: 433 SEEKAQVIQTLLFVAGLNTLLQSWFGTSLAVVIGGSYTFVASIISIILSGRWSDLDPIS 257 +EEKA+VIQTLLFVAGLNTLLQ+WFGT L VVIGGSYTFVA ISIILSGRWSD DPIS Sbjct: 67 NEEKAKVIQTLLFVAGLNTLLQTWFGTRLPVVIGGSYTFVAPTISIILSGRWSDPDPIS 125 >gb|KZV34727.1| nucleobase-ascorbate transporter 6 [Dorcoceras hygrometricum] Length = 530 Score = 102 bits (253), Expect = 9e-21 Identities = 57/88 (64%), Positives = 65/88 (73%), Gaps = 1/88 (1%) Frame = -2 Query: 433 SEEKAQVIQTLLFVAGLNTLLQSWFGTSLAVVIGGSYTFVASIISIILSGRWSDLDPISV 254 +EEKA+VIQTLLFVAGLNTLLQ+WFGT L VVIGGSYTFV+ ISIILSGRW+D +PISV Sbjct: 67 NEEKAKVIQTLLFVAGLNTLLQTWFGTRLPVVIGGSYTFVSPTISIILSGRWNDPNPISV 126 Query: 253 TLPDFFLADQFTSQVSCYAEIPFG-SGL 173 A Q V+ +I G SGL Sbjct: 127 RFKKIMRATQGAFIVASTIQIVLGFSGL 154 >ref|XP_011071803.1| nucleobase-ascorbate transporter 6 [Sesamum indicum] ref|XP_011071804.1| nucleobase-ascorbate transporter 6 [Sesamum indicum] ref|XP_011071805.1| nucleobase-ascorbate transporter 6 [Sesamum indicum] ref|XP_011071806.1| nucleobase-ascorbate transporter 6 [Sesamum indicum] ref|XP_011071807.1| nucleobase-ascorbate transporter 6 [Sesamum indicum] Length = 530 Score = 102 bits (253), Expect = 9e-21 Identities = 51/59 (86%), Positives = 54/59 (91%) Frame = -2 Query: 433 SEEKAQVIQTLLFVAGLNTLLQSWFGTSLAVVIGGSYTFVASIISIILSGRWSDLDPIS 257 +EEKAQVIQTLLFVAGLNTLLQ+WFGT L VVIGGSYTFVA ISIILSGRW+D DPIS Sbjct: 68 NEEKAQVIQTLLFVAGLNTLLQTWFGTRLPVVIGGSYTFVAPTISIILSGRWNDPDPIS 126 >ref|XP_022893988.1| nucleobase-ascorbate transporter 6 [Olea europaea var. sylvestris] ref|XP_022894022.1| nucleobase-ascorbate transporter 6 [Olea europaea var. sylvestris] Length = 529 Score = 101 bits (252), Expect = 1e-20 Identities = 51/59 (86%), Positives = 54/59 (91%) Frame = -2 Query: 433 SEEKAQVIQTLLFVAGLNTLLQSWFGTSLAVVIGGSYTFVASIISIILSGRWSDLDPIS 257 +EEKA+VIQTLLFVAGLNTLLQ+WFGT L VVIGGSYTFVA ISIILSGRWSD DPIS Sbjct: 67 NEEKAKVIQTLLFVAGLNTLLQTWFGTRLPVVIGGSYTFVAPTISIILSGRWSDPDPIS 125 >gb|EYU29931.1| hypothetical protein MIMGU_mgv1a026566mg, partial [Erythranthe guttata] Length = 363 Score = 100 bits (248), Expect = 1e-20 Identities = 49/59 (83%), Positives = 54/59 (91%) Frame = -2 Query: 433 SEEKAQVIQTLLFVAGLNTLLQSWFGTSLAVVIGGSYTFVASIISIILSGRWSDLDPIS 257 +EEKA+VIQTLLFVAGLNTLLQ+WFGT L VVIGGSYTFVA ISIILSGRW+D DP+S Sbjct: 67 NEEKAKVIQTLLFVAGLNTLLQTWFGTRLPVVIGGSYTFVAPTISIILSGRWNDPDPVS 125 >gb|EPS60302.1| hypothetical protein M569_14502, partial [Genlisea aurea] Length = 150 Score = 95.1 bits (235), Expect = 2e-20 Identities = 49/57 (85%), Positives = 50/57 (87%) Frame = -2 Query: 427 EKAQVIQTLLFVAGLNTLLQSWFGTSLAVVIGGSYTFVASIISIILSGRWSDLDPIS 257 EKAQVIQTLLFVAGLNTLLQSWFGT L VVIGGSYTFVA ISIILS RW+D DP S Sbjct: 34 EKAQVIQTLLFVAGLNTLLQSWFGTRLPVVIGGSYTFVAPTISIILSTRWTDPDPES 90 >ref|XP_016487535.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Nicotiana tabacum] Length = 154 Score = 95.1 bits (235), Expect = 2e-20 Identities = 47/60 (78%), Positives = 53/60 (88%) Frame = -2 Query: 433 SEEKAQVIQTLLFVAGLNTLLQSWFGTSLAVVIGGSYTFVASIISIILSGRWSDLDPISV 254 +EEKA+VIQTLLFVAGLNTLLQS FGT L V+GGSYTFVA +SII+SGRWSD DP+SV Sbjct: 71 NEEKAKVIQTLLFVAGLNTLLQSLFGTRLPAVMGGSYTFVAPTVSIIISGRWSDEDPVSV 130 >ref|XP_012846286.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Erythranthe guttata] Length = 423 Score = 100 bits (248), Expect = 2e-20 Identities = 49/59 (83%), Positives = 54/59 (91%) Frame = -2 Query: 433 SEEKAQVIQTLLFVAGLNTLLQSWFGTSLAVVIGGSYTFVASIISIILSGRWSDLDPIS 257 +EEKA+VIQTLLFVAGLNTLLQ+WFGT L VVIGGSYTFVA ISIILSGRW+D DP+S Sbjct: 67 NEEKAKVIQTLLFVAGLNTLLQTWFGTRLPVVIGGSYTFVAPTISIILSGRWNDPDPVS 125 >gb|KZV39691.1| nucleobase-ascorbate transporter 6 [Dorcoceras hygrometricum] Length = 531 Score = 100 bits (248), Expect = 4e-20 Identities = 50/59 (84%), Positives = 53/59 (89%) Frame = -2 Query: 433 SEEKAQVIQTLLFVAGLNTLLQSWFGTSLAVVIGGSYTFVASIISIILSGRWSDLDPIS 257 +EEKA+VIQTLLFVAGLNTLLQ+WFGT L VIGGSYTFVA ISIILSGRWSD DPIS Sbjct: 69 NEEKAKVIQTLLFVAGLNTLLQTWFGTRLPAVIGGSYTFVAPTISIILSGRWSDPDPIS 127 >ref|XP_011087158.1| nucleobase-ascorbate transporter 6 [Sesamum indicum] ref|XP_011087159.1| nucleobase-ascorbate transporter 6 [Sesamum indicum] ref|XP_011087161.1| nucleobase-ascorbate transporter 6 [Sesamum indicum] ref|XP_011087162.1| nucleobase-ascorbate transporter 6 [Sesamum indicum] Length = 531 Score = 99.8 bits (247), Expect = 6e-20 Identities = 49/59 (83%), Positives = 53/59 (89%) Frame = -2 Query: 433 SEEKAQVIQTLLFVAGLNTLLQSWFGTSLAVVIGGSYTFVASIISIILSGRWSDLDPIS 257 +EEKA+VIQTLLFVAGLNTLLQ+WFGT L VIGGSYTFVA ISIILSGRWSD DP+S Sbjct: 69 NEEKAKVIQTLLFVAGLNTLLQTWFGTRLPAVIGGSYTFVAPTISIILSGRWSDPDPVS 127 >gb|KZV52114.1| nucleobase-ascorbate transporter 6 [Dorcoceras hygrometricum] Length = 525 Score = 97.8 bits (242), Expect = 3e-19 Identities = 49/59 (83%), Positives = 52/59 (88%) Frame = -2 Query: 433 SEEKAQVIQTLLFVAGLNTLLQSWFGTSLAVVIGGSYTFVASIISIILSGRWSDLDPIS 257 +EEKA+VIQTLL VAGLNTLLQ+WFGT L VIGGSYTFVA ISIILSGRWSD DPIS Sbjct: 63 NEEKAKVIQTLLLVAGLNTLLQTWFGTRLPAVIGGSYTFVAPTISIILSGRWSDPDPIS 121 >ref|XP_019252846.1| PREDICTED: nucleobase-ascorbate transporter 6 [Nicotiana attenuata] gb|OIT08705.1| nucleobase-ascorbate transporter 6 [Nicotiana attenuata] Length = 534 Score = 97.4 bits (241), Expect = 4e-19 Identities = 51/59 (86%), Positives = 52/59 (88%) Frame = -2 Query: 433 SEEKAQVIQTLLFVAGLNTLLQSWFGTSLAVVIGGSYTFVASIISIILSGRWSDLDPIS 257 +EEKAQVIQTLLFVAGLNTLLQS FGT L VIGGSYTFVA ISIILSGRWSD DPIS Sbjct: 72 NEEKAQVIQTLLFVAGLNTLLQSIFGTRLPAVIGGSYTFVAPTISIILSGRWSDEDPIS 130 >ref|XP_016503856.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X4 [Nicotiana tabacum] ref|XP_018628437.1| PREDICTED: nucleobase-ascorbate transporter 6 isoform X2 [Nicotiana tomentosiformis] Length = 482 Score = 97.1 bits (240), Expect = 4e-19 Identities = 50/59 (84%), Positives = 52/59 (88%) Frame = -2 Query: 433 SEEKAQVIQTLLFVAGLNTLLQSWFGTSLAVVIGGSYTFVASIISIILSGRWSDLDPIS 257 +EEKAQVIQTLLFVAGLNTLLQS FGT L V+GGSYTFVA ISIILSGRWSD DPIS Sbjct: 20 NEEKAQVIQTLLFVAGLNTLLQSIFGTRLPAVVGGSYTFVAPTISIILSGRWSDEDPIS 78 >ref|XP_009608483.1| PREDICTED: nucleobase-ascorbate transporter 6 isoform X1 [Nicotiana tomentosiformis] ref|XP_009608484.1| PREDICTED: nucleobase-ascorbate transporter 6 isoform X1 [Nicotiana tomentosiformis] ref|XP_009608485.1| PREDICTED: nucleobase-ascorbate transporter 6 isoform X1 [Nicotiana tomentosiformis] ref|XP_009608486.1| PREDICTED: nucleobase-ascorbate transporter 6 isoform X1 [Nicotiana tomentosiformis] ref|XP_016503851.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X3 [Nicotiana tabacum] ref|XP_016503852.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X3 [Nicotiana tabacum] ref|XP_016503853.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X3 [Nicotiana tabacum] ref|XP_016503854.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X3 [Nicotiana tabacum] ref|XP_016503855.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X3 [Nicotiana tabacum] ref|XP_018628436.1| PREDICTED: nucleobase-ascorbate transporter 6 isoform X1 [Nicotiana tomentosiformis] Length = 532 Score = 97.1 bits (240), Expect = 5e-19 Identities = 50/59 (84%), Positives = 52/59 (88%) Frame = -2 Query: 433 SEEKAQVIQTLLFVAGLNTLLQSWFGTSLAVVIGGSYTFVASIISIILSGRWSDLDPIS 257 +EEKAQVIQTLLFVAGLNTLLQS FGT L V+GGSYTFVA ISIILSGRWSD DPIS Sbjct: 70 NEEKAQVIQTLLFVAGLNTLLQSIFGTRLPAVVGGSYTFVAPTISIILSGRWSDEDPIS 128 >ref|XP_016503850.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X2 [Nicotiana tabacum] Length = 577 Score = 97.1 bits (240), Expect = 6e-19 Identities = 50/59 (84%), Positives = 52/59 (88%) Frame = -2 Query: 433 SEEKAQVIQTLLFVAGLNTLLQSWFGTSLAVVIGGSYTFVASIISIILSGRWSDLDPIS 257 +EEKAQVIQTLLFVAGLNTLLQS FGT L V+GGSYTFVA ISIILSGRWSD DPIS Sbjct: 128 NEEKAQVIQTLLFVAGLNTLLQSIFGTRLPAVVGGSYTFVAPTISIILSGRWSDEDPIS 186 >ref|XP_016503849.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 [Nicotiana tabacum] Length = 590 Score = 97.1 bits (240), Expect = 6e-19 Identities = 50/59 (84%), Positives = 52/59 (88%) Frame = -2 Query: 433 SEEKAQVIQTLLFVAGLNTLLQSWFGTSLAVVIGGSYTFVASIISIILSGRWSDLDPIS 257 +EEKAQVIQTLLFVAGLNTLLQS FGT L V+GGSYTFVA ISIILSGRWSD DPIS Sbjct: 128 NEEKAQVIQTLLFVAGLNTLLQSIFGTRLPAVVGGSYTFVAPTISIILSGRWSDEDPIS 186 >ref|XP_012831180.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Erythranthe guttata] gb|EYU42538.1| hypothetical protein MIMGU_mgv1a004467mg [Erythranthe guttata] Length = 525 Score = 96.7 bits (239), Expect = 7e-19 Identities = 48/59 (81%), Positives = 52/59 (88%) Frame = -2 Query: 433 SEEKAQVIQTLLFVAGLNTLLQSWFGTSLAVVIGGSYTFVASIISIILSGRWSDLDPIS 257 +EEKA+VIQTLLFVAGLNTLLQ+WFGT L VVIG SYT+VA ISIILSGRW D DPIS Sbjct: 63 NEEKAKVIQTLLFVAGLNTLLQTWFGTRLPVVIGASYTYVAPTISIILSGRWDDPDPIS 121 >ref|XP_022885310.1| nucleobase-ascorbate transporter 6-like [Olea europaea var. sylvestris] ref|XP_022885311.1| nucleobase-ascorbate transporter 6-like [Olea europaea var. sylvestris] ref|XP_022885312.1| nucleobase-ascorbate transporter 6-like [Olea europaea var. sylvestris] Length = 528 Score = 96.3 bits (238), Expect = 9e-19 Identities = 49/59 (83%), Positives = 53/59 (89%) Frame = -2 Query: 433 SEEKAQVIQTLLFVAGLNTLLQSWFGTSLAVVIGGSYTFVASIISIILSGRWSDLDPIS 257 +EEKA+VIQTLLFVAGLNTLLQS FGT L VVIGGSYTFVA ISIILSGRW+D DP+S Sbjct: 66 NEEKAKVIQTLLFVAGLNTLLQSLFGTRLPVVIGGSYTFVAPTISIILSGRWNDPDPVS 124 >ref|XP_016466374.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Nicotiana tabacum] ref|XP_016466375.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Nicotiana tabacum] Length = 346 Score = 94.7 bits (234), Expect = 1e-18 Identities = 49/59 (83%), Positives = 51/59 (86%) Frame = -2 Query: 433 SEEKAQVIQTLLFVAGLNTLLQSWFGTSLAVVIGGSYTFVASIISIILSGRWSDLDPIS 257 +EEKAQVIQTLL VAGLNTLLQS FGT L VIGGSYTFVA ISIILSGRWSD DP+S Sbjct: 70 NEEKAQVIQTLLLVAGLNTLLQSIFGTRLPAVIGGSYTFVAPTISIILSGRWSDEDPVS 128