BLASTX nr result
ID: Rehmannia30_contig00020955
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00020955 (966 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011102127.1| uncharacterized protein LOC105180157 [Sesamu... 59 5e-06 >ref|XP_011102127.1| uncharacterized protein LOC105180157 [Sesamum indicum] Length = 658 Score = 59.3 bits (142), Expect = 5e-06 Identities = 24/40 (60%), Positives = 32/40 (80%) Frame = +3 Query: 825 ILGGFFYWLQNVSQEGAFKPWKYGQCLAVEPGSPKNSQPP 944 IL GFF+WLQ++++EGAFKPWK G+CLAVEP + + P Sbjct: 617 ILRGFFFWLQHLTREGAFKPWKDGECLAVEPEDLRETSSP 656