BLASTX nr result
ID: Rehmannia30_contig00020528
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00020528 (518 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011081619.1| beta-glucosidase 13-like [Sesamum indicum] 58 1e-06 ref|XP_011081620.1| beta-glucosidase 24-like [Sesamum indicum] 58 1e-06 ref|XP_011081623.1| beta-glucosidase 24-like [Sesamum indicum] 56 5e-06 >ref|XP_011081619.1| beta-glucosidase 13-like [Sesamum indicum] Length = 625 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +1 Query: 409 NSKAKDDNSGISRHDFPEDFVFGTATSSYQFEGAAA 516 NSK ++ NS ISRHDFP +F+FG+AT++YQFEG AA Sbjct: 25 NSKVRNHNSNISRHDFPSNFIFGSATAAYQFEGGAA 60 >ref|XP_011081620.1| beta-glucosidase 24-like [Sesamum indicum] Length = 626 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +1 Query: 409 NSKAKDDNSGISRHDFPEDFVFGTATSSYQFEGAAA 516 NSK ++ NS ISRHDFP +F+FG+AT++YQFEG AA Sbjct: 25 NSKVRNHNSNISRHDFPSNFIFGSATAAYQFEGGAA 60 >ref|XP_011081623.1| beta-glucosidase 24-like [Sesamum indicum] Length = 622 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +1 Query: 409 NSKAKDDNSGISRHDFPEDFVFGTATSSYQFEGAAA 516 NSK ++ NS I+RHDFP F+FG+AT++YQFEGAAA Sbjct: 25 NSKVRNHNSHITRHDFPPHFIFGSATAAYQFEGAAA 60