BLASTX nr result
ID: Rehmannia30_contig00019942
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00019942 (502 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN17499.1| hypothetical protein CDL12_09845 [Handroanthus im... 70 1e-11 gb|PIN15042.1| hypothetical protein CDL12_12305 [Handroanthus im... 70 1e-11 gb|PIN26719.1| hypothetical protein CDL12_00529 [Handroanthus im... 65 7e-10 gb|PIN08003.1| hypothetical protein CDL12_19421 [Handroanthus im... 59 7e-08 ref|XP_011089302.1| anther-specific proline-rich protein APG [Se... 58 2e-07 >gb|PIN17499.1| hypothetical protein CDL12_09845 [Handroanthus impetiginosus] Length = 190 Score = 69.7 bits (169), Expect = 1e-11 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 5/50 (10%) Frame = +3 Query: 366 SGEDDVP-----RKKSPSPAPAVVGDVSHEDRSNSDDLETKDDSSGGMNG 500 SGEDD R SPSPAPAVVGD++HED+SN+ +LETKDDSSGGM+G Sbjct: 96 SGEDDTDYSENKRSPSPSPAPAVVGDINHEDQSNAGNLETKDDSSGGMSG 145 >gb|PIN15042.1| hypothetical protein CDL12_12305 [Handroanthus impetiginosus] Length = 190 Score = 69.7 bits (169), Expect = 1e-11 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 5/50 (10%) Frame = +3 Query: 366 SGEDDVP-----RKKSPSPAPAVVGDVSHEDRSNSDDLETKDDSSGGMNG 500 SGEDD R SPSPAPAVVGD++HED+SN+ +LETKDDSSGGM+G Sbjct: 96 SGEDDTDYSENKRSPSPSPAPAVVGDINHEDQSNAGNLETKDDSSGGMSG 145 >gb|PIN26719.1| hypothetical protein CDL12_00529 [Handroanthus impetiginosus] Length = 172 Score = 64.7 bits (156), Expect = 7e-10 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +3 Query: 375 DDVPRKKSPSPAPAVVGDVSHEDRSNSDDLETKDDSSGGMNG 500 +D KKSP+PAPAVVGD+SHE+ N+ DLETK+ SSGGMNG Sbjct: 86 NDTADKKSPAPAPAVVGDISHENHPNAADLETKEKSSGGMNG 127 >gb|PIN08003.1| hypothetical protein CDL12_19421 [Handroanthus impetiginosus] Length = 172 Score = 59.3 bits (142), Expect = 7e-08 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = +3 Query: 375 DDVPRKKSPSPAPAVVGDVSHEDRSNSDDLETKDDSSGGMN 497 +D+ +KSP+PAPAVVGD SHE+ N+ DLETK SSGGMN Sbjct: 86 NDIADEKSPAPAPAVVGDFSHENHPNAADLETKKKSSGGMN 126 >ref|XP_011089302.1| anther-specific proline-rich protein APG [Sesamum indicum] Length = 168 Score = 58.2 bits (139), Expect = 2e-07 Identities = 27/47 (57%), Positives = 36/47 (76%), Gaps = 4/47 (8%) Frame = +3 Query: 372 EDDVPRKK----SPSPAPAVVGDVSHEDRSNSDDLETKDDSSGGMNG 500 +DDVP ++ +P+PAP VVGD HED+SN+ DL+ K DSSGGM+G Sbjct: 77 DDDVPYEQKNIPTPAPAPVVVGDFRHEDQSNAGDLDAKGDSSGGMSG 123