BLASTX nr result
ID: Rehmannia30_contig00019813
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00019813 (888 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25755.1| hypothetical protein MIMGU_mgv1a026540mg [Erythra... 86 4e-15 ref|XP_012851341.1| PREDICTED: pentatricopeptide repeat-containi... 86 4e-15 ref|XP_011094045.1| pentatricopeptide repeat-containing protein ... 85 8e-15 ref|XP_011094044.1| pentatricopeptide repeat-containing protein ... 85 9e-15 gb|PIN07100.1| hypothetical protein CDL12_20334 [Handroanthus im... 78 1e-12 ref|XP_022883048.1| pentatricopeptide repeat-containing protein ... 71 3e-10 ref|XP_022883047.1| pentatricopeptide repeat-containing protein ... 71 3e-10 ref|XP_021983017.1| pentatricopeptide repeat-containing protein ... 69 2e-09 ref|XP_021983016.1| pentatricopeptide repeat-containing protein ... 69 2e-09 ref|XP_012083449.1| pentatricopeptide repeat-containing protein ... 68 3e-09 ref|XP_020538397.1| pentatricopeptide repeat-containing protein ... 68 4e-09 ref|XP_024009736.1| pentatricopeptide repeat-containing protein ... 68 4e-09 ref|XP_006418860.1| pentatricopeptide repeat-containing protein ... 68 5e-09 ref|XP_010425791.1| PREDICTED: pentatricopeptide repeat-containi... 67 6e-09 ref|XP_010496527.1| PREDICTED: pentatricopeptide repeat-containi... 67 6e-09 ref|XP_013668942.1| pentatricopeptide repeat-containing protein ... 64 6e-09 ref|XP_008366189.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 64 8e-09 gb|KZV26809.1| pentatricopeptide repeat-containing protein [Dorc... 67 9e-09 gb|PLY64586.1| hypothetical protein LSAT_6X31220 [Lactuca sativa] 62 2e-08 ref|XP_020251620.1| pentatricopeptide repeat-containing protein ... 65 2e-08 >gb|EYU25755.1| hypothetical protein MIMGU_mgv1a026540mg [Erythranthe guttata] Length = 400 Score = 85.5 bits (210), Expect = 4e-15 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = -2 Query: 887 DFHSNSEVVMEYVKKKNWTYKMLISIYLKKKFRSNQIFWNY 765 DFHS+SEVVMEYVK+K+WTYKMLIS+YLKKKFRSNQIFWNY Sbjct: 360 DFHSSSEVVMEYVKRKDWTYKMLISVYLKKKFRSNQIFWNY 400 >ref|XP_012851341.1| PREDICTED: pentatricopeptide repeat-containing protein At3g42630 [Erythranthe guttata] Length = 411 Score = 85.5 bits (210), Expect = 4e-15 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = -2 Query: 887 DFHSNSEVVMEYVKKKNWTYKMLISIYLKKKFRSNQIFWNY 765 DFHS+SEVVMEYVK+K+WTYKMLIS+YLKKKFRSNQIFWNY Sbjct: 371 DFHSSSEVVMEYVKRKDWTYKMLISVYLKKKFRSNQIFWNY 411 >ref|XP_011094045.1| pentatricopeptide repeat-containing protein At3g42630 isoform X2 [Sesamum indicum] Length = 419 Score = 84.7 bits (208), Expect = 8e-15 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -2 Query: 887 DFHSNSEVVMEYVKKKNWTYKMLISIYLKKKFRSNQIFWNY 765 DFH NSEVVMEYVKKK+WTYKM+I+IYLKKKFRSNQIFWNY Sbjct: 379 DFHLNSEVVMEYVKKKDWTYKMIIAIYLKKKFRSNQIFWNY 419 >ref|XP_011094044.1| pentatricopeptide repeat-containing protein At3g42630 isoform X1 [Sesamum indicum] Length = 420 Score = 84.7 bits (208), Expect = 9e-15 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -2 Query: 887 DFHSNSEVVMEYVKKKNWTYKMLISIYLKKKFRSNQIFWNY 765 DFH NSEVVMEYVKKK+WTYKM+I+IYLKKKFRSNQIFWNY Sbjct: 380 DFHLNSEVVMEYVKKKDWTYKMIIAIYLKKKFRSNQIFWNY 420 >gb|PIN07100.1| hypothetical protein CDL12_20334 [Handroanthus impetiginosus] Length = 347 Score = 77.8 bits (190), Expect = 1e-12 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = -2 Query: 887 DFHSNSEVVMEYVKKKNWTYKMLISIYLKKKFRSNQIFWNY 765 DFH NSEVV+EY KK+WTYKMLI+IYLKKK RSNQIFWNY Sbjct: 307 DFHLNSEVVLEYAGKKDWTYKMLIAIYLKKKLRSNQIFWNY 347 >ref|XP_022883048.1| pentatricopeptide repeat-containing protein At3g42630 isoform X2 [Olea europaea var. sylvestris] Length = 402 Score = 71.2 bits (173), Expect = 3e-10 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = -2 Query: 887 DFHSNSEVVMEYVKKKNWTYKMLISIYLKKKFRSNQIFWNY 765 DFH SE+ +EY +KK WTY MLI+ YLKKKFRSNQIFWNY Sbjct: 362 DFHLFSEMTLEYTRKKKWTYNMLITTYLKKKFRSNQIFWNY 402 >ref|XP_022883047.1| pentatricopeptide repeat-containing protein At3g42630 isoform X1 [Olea europaea var. sylvestris] Length = 442 Score = 71.2 bits (173), Expect = 3e-10 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = -2 Query: 887 DFHSNSEVVMEYVKKKNWTYKMLISIYLKKKFRSNQIFWNY 765 DFH SE+ +EY +KK WTY MLI+ YLKKKFRSNQIFWNY Sbjct: 402 DFHLFSEMTLEYTRKKKWTYNMLITTYLKKKFRSNQIFWNY 442 >ref|XP_021983017.1| pentatricopeptide repeat-containing protein At3g42630 isoform X2 [Helianthus annuus] Length = 416 Score = 68.9 bits (167), Expect = 2e-09 Identities = 28/41 (68%), Positives = 36/41 (87%) Frame = -2 Query: 887 DFHSNSEVVMEYVKKKNWTYKMLISIYLKKKFRSNQIFWNY 765 DFHS+SE ++E+ +K WTYK LI+IY+KKK+RSNQIFWNY Sbjct: 376 DFHSSSEALLEFNMRKTWTYKELIAIYVKKKYRSNQIFWNY 416 >ref|XP_021983016.1| pentatricopeptide repeat-containing protein At3g42630 isoform X1 [Helianthus annuus] gb|OTG15580.1| putative pentatricopeptide repeat (PPR) superfamily protein [Helianthus annuus] Length = 417 Score = 68.9 bits (167), Expect = 2e-09 Identities = 28/41 (68%), Positives = 36/41 (87%) Frame = -2 Query: 887 DFHSNSEVVMEYVKKKNWTYKMLISIYLKKKFRSNQIFWNY 765 DFHS+SE ++E+ +K WTYK LI+IY+KKK+RSNQIFWNY Sbjct: 377 DFHSSSEALLEFNMRKTWTYKELIAIYVKKKYRSNQIFWNY 417 >ref|XP_012083449.1| pentatricopeptide repeat-containing protein At3g42630 isoform X2 [Jatropha curcas] ref|XP_020538398.1| pentatricopeptide repeat-containing protein At3g42630 isoform X2 [Jatropha curcas] Length = 354 Score = 68.2 bits (165), Expect = 3e-09 Identities = 26/41 (63%), Positives = 36/41 (87%) Frame = -2 Query: 887 DFHSNSEVVMEYVKKKNWTYKMLISIYLKKKFRSNQIFWNY 765 DFHS++E +E+ +KK WTYK L+S+YL+K++RSNQIFWNY Sbjct: 314 DFHSSAEAFLEFKRKKKWTYKELVSLYLRKQYRSNQIFWNY 354 >ref|XP_020538397.1| pentatricopeptide repeat-containing protein At3g42630 isoform X1 [Jatropha curcas] gb|KDP28668.1| hypothetical protein JCGZ_14439 [Jatropha curcas] Length = 429 Score = 68.2 bits (165), Expect = 4e-09 Identities = 26/41 (63%), Positives = 36/41 (87%) Frame = -2 Query: 887 DFHSNSEVVMEYVKKKNWTYKMLISIYLKKKFRSNQIFWNY 765 DFHS++E +E+ +KK WTYK L+S+YL+K++RSNQIFWNY Sbjct: 389 DFHSSAEAFLEFKRKKKWTYKELVSLYLRKQYRSNQIFWNY 429 >ref|XP_024009736.1| pentatricopeptide repeat-containing protein At3g42630 isoform X2 [Eutrema salsugineum] Length = 343 Score = 67.8 bits (164), Expect = 4e-09 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = -2 Query: 887 DFHSNSEVVMEYVKKKNWTYKMLISIYLKKKFRSNQIFWNY 765 DFH +SE V+E+ ++KNWTY+ LI +YLKKKFR +QIFWNY Sbjct: 303 DFHLSSEAVLEFGQRKNWTYRKLIGVYLKKKFRRDQIFWNY 343 >ref|XP_006418860.1| pentatricopeptide repeat-containing protein At3g42630 isoform X1 [Eutrema salsugineum] gb|ESQ37296.1| hypothetical protein EUTSA_v10003041mg [Eutrema salsugineum] Length = 424 Score = 67.8 bits (164), Expect = 5e-09 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = -2 Query: 887 DFHSNSEVVMEYVKKKNWTYKMLISIYLKKKFRSNQIFWNY 765 DFH +SE V+E+ ++KNWTY+ LI +YLKKKFR +QIFWNY Sbjct: 384 DFHLSSEAVLEFGQRKNWTYRKLIGVYLKKKFRRDQIFWNY 424 >ref|XP_010425791.1| PREDICTED: pentatricopeptide repeat-containing protein At3g42630-like [Camelina sativa] Length = 421 Score = 67.4 bits (163), Expect = 6e-09 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -2 Query: 887 DFHSNSEVVMEYVKKKNWTYKMLISIYLKKKFRSNQIFWNY 765 DFH +SE V+E+ +KNWTY+MLI +YLKKK R +QIFWNY Sbjct: 381 DFHLSSEAVLEFSPRKNWTYRMLIGVYLKKKLRRDQIFWNY 421 >ref|XP_010496527.1| PREDICTED: pentatricopeptide repeat-containing protein At3g42630-like [Camelina sativa] Length = 422 Score = 67.4 bits (163), Expect = 6e-09 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -2 Query: 887 DFHSNSEVVMEYVKKKNWTYKMLISIYLKKKFRSNQIFWNY 765 DFH +SE V+E+ +KNWTY+MLI +YLKKK R +QIFWNY Sbjct: 382 DFHLSSEAVLEFSPRKNWTYRMLIGVYLKKKLRRDQIFWNY 422 >ref|XP_013668942.1| pentatricopeptide repeat-containing protein At3g42630-like [Brassica napus] Length = 158 Score = 64.3 bits (155), Expect = 6e-09 Identities = 25/41 (60%), Positives = 34/41 (82%) Frame = -2 Query: 887 DFHSNSEVVMEYVKKKNWTYKMLISIYLKKKFRSNQIFWNY 765 DFH +SE V+E+ +++NWTY+ LI +YLKKK R +QIFWNY Sbjct: 118 DFHLSSEAVLEFGQRRNWTYRKLIGVYLKKKLRRDQIFWNY 158 >ref|XP_008366189.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At3g42630-like [Malus domestica] Length = 172 Score = 64.3 bits (155), Expect = 8e-09 Identities = 24/41 (58%), Positives = 34/41 (82%) Frame = -2 Query: 887 DFHSNSEVVMEYVKKKNWTYKMLISIYLKKKFRSNQIFWNY 765 DFH++SE +E+ +++ WTY+ LIS+YLKK +R NQIFWNY Sbjct: 132 DFHASSEAFLEFQRQREWTYRKLISVYLKKTYRGNQIFWNY 172 >gb|KZV26809.1| pentatricopeptide repeat-containing protein [Dorcoceras hygrometricum] Length = 348 Score = 66.6 bits (161), Expect = 9e-09 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = -2 Query: 887 DFHSNSEVVMEYVKKKNWTYKMLISIYLKKKFRSNQIFWNY 765 DFHS+SEVV+ ++WTYK LI IYLKK+FRSNQIFWNY Sbjct: 308 DFHSSSEVVLGNSTNEDWTYKRLIDIYLKKRFRSNQIFWNY 348 >gb|PLY64586.1| hypothetical protein LSAT_6X31220 [Lactuca sativa] Length = 134 Score = 62.4 bits (150), Expect = 2e-08 Identities = 27/42 (64%), Positives = 36/42 (85%), Gaps = 1/42 (2%) Frame = -2 Query: 887 DFHSNSEVVMEYVK-KKNWTYKMLISIYLKKKFRSNQIFWNY 765 DFHS+SE ++E+ + KK W+YK LI+ Y+KKK+RSNQIFWNY Sbjct: 93 DFHSSSEPLLEFNRGKKRWSYKELIATYVKKKYRSNQIFWNY 134 >ref|XP_020251620.1| pentatricopeptide repeat-containing protein At3g42630 isoform X2 [Asparagus officinalis] gb|ONK81323.1| uncharacterized protein A4U43_C01F27810 [Asparagus officinalis] Length = 327 Score = 65.5 bits (158), Expect = 2e-08 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -2 Query: 887 DFHSNSEVVMEYVKKKNWTYKMLISIYLKKKFRSNQIFWNY 765 DFHS+SEVV+E K++ WTY L+ +YLKK++R NQIFWNY Sbjct: 287 DFHSSSEVVLESSKRREWTYSKLVKMYLKKQYRRNQIFWNY 327