BLASTX nr result
ID: Rehmannia30_contig00019798
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00019798 (503 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022888959.1| pentatricopeptide repeat-containing protein ... 73 7e-12 ref|XP_011094749.1| pentatricopeptide repeat-containing protein ... 72 2e-11 ref|XP_012831937.1| PREDICTED: pentatricopeptide repeat-containi... 66 2e-09 dbj|GAV84190.1| PPR domain-containing protein/PPR_2 domain-conta... 60 2e-07 ref|XP_018835388.1| PREDICTED: pentatricopeptide repeat-containi... 59 5e-07 ref|XP_021852264.1| pentatricopeptide repeat-containing protein ... 59 5e-07 gb|PPD92329.1| hypothetical protein GOBAR_DD10733 [Gossypium bar... 58 1e-06 ref|XP_016679045.1| PREDICTED: pentatricopeptide repeat-containi... 58 1e-06 ref|XP_012443371.1| PREDICTED: pentatricopeptide repeat-containi... 58 1e-06 ref|XP_012443370.1| PREDICTED: pentatricopeptide repeat-containi... 58 1e-06 gb|KZV51570.1| pentatricopeptide repeat-containing protein chlor... 57 2e-06 ref|XP_019077254.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 ref|XP_019077253.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 ref|XP_002273255.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 ref|XP_010653452.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 gb|POE44688.1| pentatricopeptide repeat-containing protein, chlo... 56 5e-06 ref|XP_023905056.1| pentatricopeptide repeat-containing protein ... 56 5e-06 ref|XP_010696356.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 ref|XP_019102681.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 >ref|XP_022888959.1| pentatricopeptide repeat-containing protein At5g02830, chloroplastic [Olea europaea var. sylvestris] Length = 418 Score = 72.8 bits (177), Expect = 7e-12 Identities = 35/58 (60%), Positives = 46/58 (79%) Frame = +2 Query: 2 RRDKESPAHSNLNLEETREKSGSPQALESPTRRPVVLQRLKVTRKSLNHWLQRRTRSS 175 + D E+P SNL LE+ + SPQ LESPTRRPVVLQRLK+T++SL+HWLQR+T ++ Sbjct: 360 KSDVENPVCSNLKLEDLKRSGPSPQ-LESPTRRPVVLQRLKITKESLHHWLQRKTAAT 416 >ref|XP_011094749.1| pentatricopeptide repeat-containing protein At5g02830, chloroplastic [Sesamum indicum] Length = 848 Score = 72.0 bits (175), Expect = 2e-11 Identities = 39/60 (65%), Positives = 47/60 (78%), Gaps = 1/60 (1%) Frame = +2 Query: 2 RRDKESPAHSNLNLEETREKSGSPQALESPT-RRPVVLQRLKVTRKSLNHWLQRRTRSST 178 RRD+ SP HSNL LEE ++S P A ESPT RRP+VLQRLKVTR+SL+ WLQR+ +ST Sbjct: 785 RRDQGSPTHSNLKLEEF-DRSSLPHAPESPTTRRPLVLQRLKVTRESLHRWLQRKVGTST 843 >ref|XP_012831937.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic [Erythranthe guttata] gb|EYU41644.1| hypothetical protein MIMGU_mgv1a001284mg [Erythranthe guttata] Length = 847 Score = 65.9 bits (159), Expect = 2e-09 Identities = 35/57 (61%), Positives = 45/57 (78%) Frame = +2 Query: 5 RDKESPAHSNLNLEETREKSGSPQALESPTRRPVVLQRLKVTRKSLNHWLQRRTRSS 175 R K S +S+ ++ ET E+S S QA ESPTRRP+VLQRLKVTR+SL+HWLQ++ SS Sbjct: 783 RGKGSRMYSS-SIGETIERSESKQASESPTRRPMVLQRLKVTRESLHHWLQKKMESS 838 >dbj|GAV84190.1| PPR domain-containing protein/PPR_2 domain-containing protein/PPR_3 domain-containing protein [Cephalotus follicularis] Length = 846 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/50 (56%), Positives = 39/50 (78%) Frame = +2 Query: 14 ESPAHSNLNLEETREKSGSPQALESPTRRPVVLQRLKVTRKSLNHWLQRR 163 E P +++ NL++ ++ + L SPTRRPV+LQRLKVTRKSL+HWLQR+ Sbjct: 791 EYPFNTDANLKDVLGRNRLSRELLSPTRRPVILQRLKVTRKSLHHWLQRK 840 >ref|XP_018835388.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic [Juglans regia] Length = 861 Score = 58.9 bits (141), Expect = 5e-07 Identities = 27/50 (54%), Positives = 36/50 (72%) Frame = +2 Query: 14 ESPAHSNLNLEETREKSGSPQALESPTRRPVVLQRLKVTRKSLNHWLQRR 163 E S++NLEE ++ P LE TRRP ++QRLK+TRKSL++WLQRR Sbjct: 806 ECTVESDINLEELIGRNSLPAKLECSTRRPAIVQRLKITRKSLHYWLQRR 855 >ref|XP_021852264.1| pentatricopeptide repeat-containing protein At5g02830, chloroplastic [Spinacia oleracea] gb|KNA09255.1| hypothetical protein SOVF_155200 [Spinacia oleracea] Length = 861 Score = 58.9 bits (141), Expect = 5e-07 Identities = 28/56 (50%), Positives = 36/56 (64%) Frame = +2 Query: 11 KESPAHSNLNLEETREKSGSPQALESPTRRPVVLQRLKVTRKSLNHWLQRRTRSST 178 KE + + N + S P + ++P RRP VLQRL VT+KSLNHWLQRR+ S T Sbjct: 804 KEGAFYPDSNSRDAPRMSELPNSFDAPARRPAVLQRLLVTKKSLNHWLQRRSDSGT 859 >gb|PPD92329.1| hypothetical protein GOBAR_DD10733 [Gossypium barbadense] Length = 785 Score = 57.8 bits (138), Expect = 1e-06 Identities = 30/53 (56%), Positives = 39/53 (73%) Frame = +2 Query: 8 DKESPAHSNLNLEETREKSGSPQALESPTRRPVVLQRLKVTRKSLNHWLQRRT 166 D ++P + + LE+ + S S + L S TRRPV+LQRLKV RKSLNHWLQ+RT Sbjct: 729 DLQTPGANTVLLEKAGKNSLSSKPLSS-TRRPVILQRLKVLRKSLNHWLQKRT 780 >ref|XP_016679045.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic-like [Gossypium hirsutum] Length = 840 Score = 57.8 bits (138), Expect = 1e-06 Identities = 30/53 (56%), Positives = 39/53 (73%) Frame = +2 Query: 8 DKESPAHSNLNLEETREKSGSPQALESPTRRPVVLQRLKVTRKSLNHWLQRRT 166 D ++P + + LE+ + S S + L S TRRPV+LQRLKV RKSLNHWLQ+RT Sbjct: 784 DLQTPGANTVLLEKAGKNSLSSKPLSS-TRRPVILQRLKVLRKSLNHWLQKRT 835 >ref|XP_012443371.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X2 [Gossypium raimondii] gb|KJB62519.1| hypothetical protein B456_009G420800 [Gossypium raimondii] Length = 861 Score = 57.8 bits (138), Expect = 1e-06 Identities = 30/53 (56%), Positives = 39/53 (73%) Frame = +2 Query: 8 DKESPAHSNLNLEETREKSGSPQALESPTRRPVVLQRLKVTRKSLNHWLQRRT 166 D ++P + + LE+ + S S + L S TRRPV+LQRLKV RKSLNHWLQ+RT Sbjct: 805 DLQTPGANTVLLEKAGKNSLSSKPLSS-TRRPVILQRLKVLRKSLNHWLQKRT 856 >ref|XP_012443370.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X1 [Gossypium raimondii] gb|KJB62520.1| hypothetical protein B456_009G420800 [Gossypium raimondii] Length = 862 Score = 57.8 bits (138), Expect = 1e-06 Identities = 30/53 (56%), Positives = 39/53 (73%) Frame = +2 Query: 8 DKESPAHSNLNLEETREKSGSPQALESPTRRPVVLQRLKVTRKSLNHWLQRRT 166 D ++P + + LE+ + S S + L S TRRPV+LQRLKV RKSLNHWLQ+RT Sbjct: 806 DLQTPGANTVLLEKAGKNSLSSKPLSS-TRRPVILQRLKVLRKSLNHWLQKRT 857 >gb|KZV51570.1| pentatricopeptide repeat-containing protein chloroplastic-like [Dorcoceras hygrometricum] Length = 777 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/44 (63%), Positives = 31/44 (70%) Frame = +2 Query: 47 ETREKSGSPQALESPTRRPVVLQRLKVTRKSLNHWLQRRTRSST 178 E E S P A SP+RRPV LQRLKVTR+SL HWLQRR + T Sbjct: 733 EVHEDSSLPPASRSPSRRPVALQRLKVTRESLQHWLQRRLVTPT 776 >ref|XP_019077254.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X4 [Vitis vinifera] Length = 806 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/48 (58%), Positives = 34/48 (70%) Frame = +2 Query: 20 PAHSNLNLEETREKSGSPQALESPTRRPVVLQRLKVTRKSLNHWLQRR 163 P S+ + +E ++ P LES TRRP VLQR KVTRKSL+HWLQRR Sbjct: 753 PPGSDPDWQEALGRNRLPTELESSTRRPAVLQRFKVTRKSLDHWLQRR 800 >ref|XP_019077253.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X3 [Vitis vinifera] Length = 836 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/48 (58%), Positives = 34/48 (70%) Frame = +2 Query: 20 PAHSNLNLEETREKSGSPQALESPTRRPVVLQRLKVTRKSLNHWLQRR 163 P S+ + +E ++ P LES TRRP VLQR KVTRKSL+HWLQRR Sbjct: 783 PPGSDPDWQEALGRNRLPTELESSTRRPAVLQRFKVTRKSLDHWLQRR 830 >ref|XP_002273255.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X2 [Vitis vinifera] emb|CBI32618.3| unnamed protein product, partial [Vitis vinifera] Length = 842 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/48 (58%), Positives = 34/48 (70%) Frame = +2 Query: 20 PAHSNLNLEETREKSGSPQALESPTRRPVVLQRLKVTRKSLNHWLQRR 163 P S+ + +E ++ P LES TRRP VLQR KVTRKSL+HWLQRR Sbjct: 789 PPGSDPDWQEALGRNRLPTELESSTRRPAVLQRFKVTRKSLDHWLQRR 836 >ref|XP_010653452.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X1 [Vitis vinifera] Length = 852 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/48 (58%), Positives = 34/48 (70%) Frame = +2 Query: 20 PAHSNLNLEETREKSGSPQALESPTRRPVVLQRLKVTRKSLNHWLQRR 163 P S+ + +E ++ P LES TRRP VLQR KVTRKSL+HWLQRR Sbjct: 799 PPGSDPDWQEALGRNRLPTELESSTRRPAVLQRFKVTRKSLDHWLQRR 846 >gb|POE44688.1| pentatricopeptide repeat-containing protein, chloroplastic [Quercus suber] Length = 761 Score = 56.2 bits (134), Expect = 5e-06 Identities = 29/54 (53%), Positives = 36/54 (66%) Frame = +2 Query: 2 RRDKESPAHSNLNLEETREKSGSPQALESPTRRPVVLQRLKVTRKSLNHWLQRR 163 + + ES S+LN E+ + LES TRRP V+QRLKVTRKSL +WLQRR Sbjct: 702 KTNSESLLASDLNFEQLTRRKSLLTELESSTRRPDVVQRLKVTRKSLQYWLQRR 755 >ref|XP_023905056.1| pentatricopeptide repeat-containing protein At5g02830, chloroplastic [Quercus suber] Length = 854 Score = 56.2 bits (134), Expect = 5e-06 Identities = 29/54 (53%), Positives = 36/54 (66%) Frame = +2 Query: 2 RRDKESPAHSNLNLEETREKSGSPQALESPTRRPVVLQRLKVTRKSLNHWLQRR 163 + + ES S+LN E+ + LES TRRP V+QRLKVTRKSL +WLQRR Sbjct: 795 KTNSESLLASDLNFEQLTRRKSLLTELESSTRRPDVVQRLKVTRKSLQYWLQRR 848 >ref|XP_010696356.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X2 [Beta vulgaris subsp. vulgaris] gb|KMS97002.1| hypothetical protein BVRB_7g179510 [Beta vulgaris subsp. vulgaris] Length = 864 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/51 (50%), Positives = 36/51 (70%) Frame = +2 Query: 8 DKESPAHSNLNLEETREKSGSPQALESPTRRPVVLQRLKVTRKSLNHWLQR 160 DK+ ++S L EKS P +L++P RRP VLQRL VT+KSL+HWL++ Sbjct: 807 DKKGTSNSVLKSRSVLEKSEFPYSLDTPARRPAVLQRLLVTKKSLSHWLRK 857 >ref|XP_019102681.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X1 [Beta vulgaris subsp. vulgaris] Length = 872 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/51 (50%), Positives = 36/51 (70%) Frame = +2 Query: 8 DKESPAHSNLNLEETREKSGSPQALESPTRRPVVLQRLKVTRKSLNHWLQR 160 DK+ ++S L EKS P +L++P RRP VLQRL VT+KSL+HWL++ Sbjct: 815 DKKGTSNSVLKSRSVLEKSEFPYSLDTPARRPAVLQRLLVTKKSLSHWLRK 865