BLASTX nr result
ID: Rehmannia30_contig00019697
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00019697 (463 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN11791.1| hypothetical protein CDL12_15605 [Handroanthus im... 67 5e-11 gb|PIN22811.1| hypothetical protein CDL12_04477 [Handroanthus im... 66 7e-10 >gb|PIN11791.1| hypothetical protein CDL12_15605 [Handroanthus impetiginosus] Length = 154 Score = 67.0 bits (162), Expect = 5e-11 Identities = 36/57 (63%), Positives = 43/57 (75%), Gaps = 2/57 (3%) Frame = +1 Query: 235 LQVEVKETREKQEYTKRN--GEKKKEMMYKCSYSQLGGCLSLKGLWMGTTRQRDKQK 399 ++VEVKETREKQ YT+R GE+KK M+ +CS Q GGCLSL+GLWM R RDK K Sbjct: 78 IEVEVKETREKQ-YTRRKEGGERKKHMLCRCSNRQ-GGCLSLRGLWMTILRHRDKHK 132 >gb|PIN22811.1| hypothetical protein CDL12_04477 [Handroanthus impetiginosus] Length = 311 Score = 66.2 bits (160), Expect = 7e-10 Identities = 36/56 (64%), Positives = 42/56 (75%), Gaps = 2/56 (3%) Frame = +1 Query: 238 QVEVKETREKQEYTKRN--GEKKKEMMYKCSYSQLGGCLSLKGLWMGTTRQRDKQK 399 +VEVKETREKQ YT+R GE+KK M+ +CS Q GGCLSL+GLWM R RDK K Sbjct: 236 EVEVKETREKQ-YTRRKEGGERKKHMLCRCSNRQ-GGCLSLRGLWMTILRHRDKHK 289