BLASTX nr result
ID: Rehmannia30_contig00019170
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00019170 (428 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011090808.1| AT-hook motif nuclear-localized protein 1 [S... 96 8e-21 gb|PIN23789.1| hypothetical protein CDL12_03485 [Handroanthus im... 91 4e-19 ref|XP_011093201.1| AT-hook motif nuclear-localized protein 1-li... 75 2e-13 ref|XP_020553747.1| AT-hook motif nuclear-localized protein 1-li... 75 3e-13 ref|XP_020553746.1| AT-hook motif nuclear-localized protein 7-li... 75 3e-13 >ref|XP_011090808.1| AT-hook motif nuclear-localized protein 1 [Sesamum indicum] ref|XP_011090815.1| AT-hook motif nuclear-localized protein 1 [Sesamum indicum] ref|XP_020551232.1| AT-hook motif nuclear-localized protein 1 [Sesamum indicum] Length = 313 Score = 95.5 bits (236), Expect = 8e-21 Identities = 50/77 (64%), Positives = 57/77 (74%), Gaps = 8/77 (10%) Frame = -1 Query: 428 VASFLLGGPYELKPKKQLPV--------SASKVEKMSSNSIQGPSYSNSENPTNWAAMQN 273 VASFLLG P+ELKPKK V +AS EK SS+++QGP YS S+NPT+WAAMQ Sbjct: 237 VASFLLGSPHELKPKKHFTVDALGPNGAAASNAEKRSSDNVQGPGYSISDNPTSWAAMQT 296 Query: 272 AERSRKSTADINISLHG 222 AERSRKS ADINISL G Sbjct: 297 AERSRKSKADINISLQG 313 >gb|PIN23789.1| hypothetical protein CDL12_03485 [Handroanthus impetiginosus] Length = 315 Score = 90.9 bits (224), Expect = 4e-19 Identities = 50/80 (62%), Positives = 61/80 (76%), Gaps = 6/80 (7%) Frame = -1 Query: 428 VASFLLGGPYELKPKKQLPV------SASKVEKMSSNSIQGPSYSNSENPTNWAAMQNAE 267 VASFLLG ELKPKKQ S+SKV++ +S+++QG S+SN+ENPTNW AMQ+AE Sbjct: 236 VASFLLGSSQELKPKKQQFTVDASGPSSSKVDRRNSSNVQGTSFSNTENPTNWTAMQSAE 295 Query: 266 RSRKSTADINISLHGSSGGD 207 +SRKSTADINISL S GD Sbjct: 296 KSRKSTADINISL---SDGD 312 >ref|XP_011093201.1| AT-hook motif nuclear-localized protein 1-like isoform X3 [Sesamum indicum] ref|XP_011093202.1| AT-hook motif nuclear-localized protein 1-like isoform X3 [Sesamum indicum] ref|XP_011093203.1| AT-hook motif nuclear-localized protein 1-like isoform X3 [Sesamum indicum] ref|XP_011093204.1| AT-hook motif nuclear-localized protein 1-like isoform X3 [Sesamum indicum] ref|XP_011093205.1| AT-hook motif nuclear-localized protein 1-like isoform X3 [Sesamum indicum] ref|XP_011093207.1| AT-hook motif nuclear-localized protein 1-like isoform X3 [Sesamum indicum] ref|XP_020553748.1| AT-hook motif nuclear-localized protein 1-like isoform X3 [Sesamum indicum] ref|XP_020553749.1| AT-hook motif nuclear-localized protein 1-like isoform X3 [Sesamum indicum] ref|XP_020553750.1| AT-hook motif nuclear-localized protein 1-like isoform X3 [Sesamum indicum] Length = 318 Score = 75.5 bits (184), Expect = 2e-13 Identities = 45/82 (54%), Positives = 50/82 (60%), Gaps = 13/82 (15%) Frame = -1 Query: 428 VASFLLGGPYELKPKKQLPVSA-------------SKVEKMSSNSIQGPSYSNSENPTNW 288 VASFLLG P+ K +KQ +A + V+K N Q PS S SENPTNW Sbjct: 237 VASFLLGSPFVPKSRKQKTEAAFTVDASGPNAAPATNVDKRVPNETQRPSCSASENPTNW 296 Query: 287 AAMQNAERSRKSTADINISLHG 222 AA Q AERSRKSTADINISL G Sbjct: 297 AATQVAERSRKSTADINISLQG 318 >ref|XP_020553747.1| AT-hook motif nuclear-localized protein 1-like isoform X2 [Sesamum indicum] Length = 354 Score = 75.5 bits (184), Expect = 3e-13 Identities = 45/82 (54%), Positives = 50/82 (60%), Gaps = 13/82 (15%) Frame = -1 Query: 428 VASFLLGGPYELKPKKQLPVSA-------------SKVEKMSSNSIQGPSYSNSENPTNW 288 VASFLLG P+ K +KQ +A + V+K N Q PS S SENPTNW Sbjct: 273 VASFLLGSPFVPKSRKQKTEAAFTVDASGPNAAPATNVDKRVPNETQRPSCSASENPTNW 332 Query: 287 AAMQNAERSRKSTADINISLHG 222 AA Q AERSRKSTADINISL G Sbjct: 333 AATQVAERSRKSTADINISLQG 354 >ref|XP_020553746.1| AT-hook motif nuclear-localized protein 7-like isoform X1 [Sesamum indicum] Length = 357 Score = 75.5 bits (184), Expect = 3e-13 Identities = 45/82 (54%), Positives = 50/82 (60%), Gaps = 13/82 (15%) Frame = -1 Query: 428 VASFLLGGPYELKPKKQLPVSA-------------SKVEKMSSNSIQGPSYSNSENPTNW 288 VASFLLG P+ K +KQ +A + V+K N Q PS S SENPTNW Sbjct: 276 VASFLLGSPFVPKSRKQKTEAAFTVDASGPNAAPATNVDKRVPNETQRPSCSASENPTNW 335 Query: 287 AAMQNAERSRKSTADINISLHG 222 AA Q AERSRKSTADINISL G Sbjct: 336 AATQVAERSRKSTADINISLQG 357