BLASTX nr result
ID: Rehmannia30_contig00019064
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00019064 (554 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGC78878.1| hypothetical protein (mitochondrion) [Vicia faba]... 119 1e-31 gb|AFK42885.1| unknown [Lotus japonicus] 116 1e-30 ref|XP_002534772.1| PREDICTED: ATP synthase subunit 9, mitochond... 70 1e-12 gb|PKI40725.1| hypothetical protein CRG98_038863 [Punica granatum] 68 1e-11 ref|YP_009153923.1| ATP synthase F1 subunit 9 (mitochondrion) [G... 68 1e-11 gb|ANS54530.1| ATPase subunit 9 (mitochondrion) [Cynomorium cocc... 67 4e-11 gb|ACU30263.1| ATP synthase subunit 9, partial (mitochondrion) [... 65 5e-11 gb|ABV25303.1| ATP synthase subunit 9, partial (mitochondrion) [... 65 5e-11 gb|ABV25274.1| ATP synthase subunit 9, partial (mitochondrion) [... 65 5e-11 gb|ABV25236.1| ATP synthase subunit 9, partial (mitochondrion) [... 65 5e-11 gb|ABV25234.1| ATP synthase subunit 9, partial (mitochondrion) [... 65 5e-11 gb|AAW30248.1| ATP synthase F0 subunit 9, partial (mitochondrion... 65 6e-11 gb|AAW30242.1| ATP synthase F0 subunit 9, partial (mitochondrion... 65 6e-11 gb|EEF22810.1| ATP synthase 9 mitochondrial, putative, partial [... 65 6e-11 gb|KRX85853.1| ATP synthase subunit 9, mitochondrial, partial [T... 65 7e-11 gb|ABH09172.1| ATP synthase subunit 9 (mitochondrion) [Silene un... 65 8e-11 gb|ABH09164.1| ATP synthase subunit 9 (mitochondrion) [Silene vu... 65 8e-11 gb|ABH09165.1| ATP synthase subunit 9 (mitochondrion) [Silene vu... 65 8e-11 gb|ABH09169.1| ATP synthase subunit 9 (mitochondrion) [Silene vu... 65 8e-11 gb|ANY30660.1| ATPase subunit 9, partial (mitochondrion) [Halodu... 65 8e-11 >gb|AGC78878.1| hypothetical protein (mitochondrion) [Vicia faba] gb|AGC78917.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 90 Score = 119 bits (297), Expect = 1e-31 Identities = 56/75 (74%), Positives = 61/75 (81%) Frame = -3 Query: 297 DVRRG*INRCRSCYNCFSRSCCRYWKRFQFFDSFRGAQSIIG*TIIWLCHFGLCSYRGNC 118 DVRR INRCRSCYNCFS SCCRYWKR QF +SFRG +SIIG T+I +C+ GLCS RG C Sbjct: 12 DVRRCKINRCRSCYNCFSGSCCRYWKRIQFINSFRGKKSIIGKTVIRICNPGLCSNRGYC 71 Query: 117 LVRINDGLFDLIRIL 73 LVRINDGLFD I L Sbjct: 72 LVRINDGLFDSICFL 86 >gb|AFK42885.1| unknown [Lotus japonicus] Length = 90 Score = 116 bits (290), Expect = 1e-30 Identities = 54/75 (72%), Positives = 60/75 (80%) Frame = -3 Query: 297 DVRRG*INRCRSCYNCFSRSCCRYWKRFQFFDSFRGAQSIIG*TIIWLCHFGLCSYRGNC 118 DVRR INRCRSCYNCFS SCCRYWKR QF +SFRG +SIIG +I +C+ GLCS RG C Sbjct: 12 DVRRCKINRCRSCYNCFSGSCCRYWKRIQFINSFRGKKSIIGKAVIRICNPGLCSNRGYC 71 Query: 117 LVRINDGLFDLIRIL 73 LVRINDGLFD + L Sbjct: 72 LVRINDGLFDSLCFL 86 >ref|XP_002534772.1| PREDICTED: ATP synthase subunit 9, mitochondrial [Ricinus communis] gb|EEF27607.1| ATP synthase 9 mitochondrial, putative [Ricinus communis] Length = 101 Score = 70.5 bits (171), Expect = 1e-12 Identities = 38/57 (66%), Positives = 39/57 (68%) Frame = -1 Query: 221 NVFSSLIHSVARNPSLAKQLFGYAILGFALTEXXXXXXXXXXXXXXXXX*SKKEGFN 51 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE SKKEGF+ Sbjct: 26 NVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIASFALMMAFLILFVFRSKKEGFS 82 >gb|PKI40725.1| hypothetical protein CRG98_038863 [Punica granatum] Length = 99 Score = 68.2 bits (165), Expect = 1e-11 Identities = 37/57 (64%), Positives = 38/57 (66%) Frame = -1 Query: 221 NVFSSLIHSVARNPSLAKQLFGYAILGFALTEXXXXXXXXXXXXXXXXX*SKKEGFN 51 NVFSSLIHSVARNPSLAKQ FGYAILGFALTE SKKEGF+ Sbjct: 26 NVFSSLIHSVARNPSLAKQSFGYAILGFALTEAIALFAPMMAFLILFVFRSKKEGFS 82 >ref|YP_009153923.1| ATP synthase F1 subunit 9 (mitochondrion) [Gossypium hirsutum] ref|YP_009153957.1| ATP synthase F1 subunit 9 (mitochondrion) [Gossypium harknessii] ref|YP_009177641.1| ATPase subunit 9 (mitochondrion) [Gossypium barbadense] ref|YP_009250138.1| ATPase subunit 9 (mitochondrion) [Gossypium raimondii] ref|YP_009388364.1| ATPase subunit 9 (mitochondrion) [Gossypium arboreum] ref|YP_009388440.1| ATPase subunit 9 (mitochondrion) [Gossypium davidsonii] ref|YP_009388476.1| ATPase subunit 9 (mitochondrion) [Gossypium trilobum] ref|YP_009388404.1| ATPase subunit 9 (mitochondrion) [Gossypium thurberi] ref|XP_016675415.1| PREDICTED: ATP synthase subunit 9, mitochondrial [Gossypium hirsutum] gb|AFO69202.1| ATPase subunit 9 (mitochondrion) [Gossypium hirsutum] gb|AGA54161.1| ATP synthase F1 subunit 9 (mitochondrion) [Gossypium hirsutum] gb|AGA54195.1| ATP synthase F1 subunit 9 (mitochondrion) [Gossypium harknessii] gb|AKQ51122.1| ATPase subunit 9 (mitochondrion) [Gossypium barbadense] gb|AMT85362.1| ATPase subunit 9 (mitochondrion) [Gossypium arboreum] gb|AMT85402.1| ATPase subunit 9 (mitochondrion) [Gossypium thurberi] gb|AMT85438.1| ATPase subunit 9 (mitochondrion) [Gossypium davidsonii] gb|AMT85474.1| ATPase subunit 9 (mitochondrion) [Gossypium raimondii] gb|AMT85510.1| ATPase subunit 9 (mitochondrion) [Gossypium trilobum] gb|AMY15480.1| ATPase subunit 9 (mitochondrion) [Gossypium raimondii] Length = 103 Score = 68.2 bits (165), Expect = 1e-11 Identities = 37/57 (64%), Positives = 38/57 (66%) Frame = -1 Query: 221 NVFSSLIHSVARNPSLAKQLFGYAILGFALTEXXXXXXXXXXXXXXXXX*SKKEGFN 51 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE SKKE F+ Sbjct: 26 NVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIASFAPMMAFLILSVFRSKKESFS 82 >gb|ANS54530.1| ATPase subunit 9 (mitochondrion) [Cynomorium coccineum] gb|ANS54560.1| ATPase subunit 9 (mitochondrion) [Cynomorium coccineum] Length = 108 Score = 67.0 bits (162), Expect = 4e-11 Identities = 37/62 (59%), Positives = 39/62 (62%) Frame = -1 Query: 221 NVFSSLIHSVARNPSLAKQLFGYAILGFALTEXXXXXXXXXXXXXXXXX*SKKEGFNWTD 42 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE S KEG + + Sbjct: 26 NVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIASFAPMMAFLISSVFRSNKEGVVYFE 85 Query: 41 LY 36 Y Sbjct: 86 QY 87 >gb|ACU30263.1| ATP synthase subunit 9, partial (mitochondrion) [Silene delicatula] gb|ACU30281.1| ATP synthase subunit 9, partial (mitochondrion) [Silene nana] Length = 56 Score = 65.1 bits (157), Expect = 5e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 221 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 126 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 18 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 49 >gb|ABV25303.1| ATP synthase subunit 9, partial (mitochondrion) [Silene noctiflora] gb|ACU30254.1| ATP synthase subunit 9, partial (mitochondrion) [Silene ammophila] gb|ACU30260.1| ATP synthase subunit 9, partial (mitochondrion) [Silene conica] gb|ACU30268.1| ATP synthase subunit 9, partial (mitochondrion) [Silene gallinyi] gb|ACU30270.1| ATP synthase subunit 9, partial (mitochondrion) [Silene imbricata] gb|ACU30277.1| ATP synthase subunit 9, partial (mitochondrion) [Silene macrodonta] gb|ACU30282.1| ATP synthase subunit 9, partial (mitochondrion) [Silene niceensis] gb|ACU30286.1| ATP synthase subunit 9, partial (mitochondrion) [Silene pygmaea] gb|ACU30290.1| ATP synthase subunit 9, partial (mitochondrion) [Silene schafta] gb|ACU30295.1| ATP synthase subunit 9, partial (mitochondrion) [Silene turkestanica] Length = 56 Score = 65.1 bits (157), Expect = 5e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 221 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 126 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 18 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 49 >gb|ABV25274.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25275.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25276.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25277.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25278.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25279.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25280.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25281.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25282.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25283.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25284.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25285.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25286.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25287.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25288.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25289.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25290.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25291.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25292.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25293.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25294.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25295.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25296.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25297.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25298.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25299.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25300.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25301.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ACU30247.1| ATP synthase subunit 9, partial (mitochondrion) [Agrostemma githago] gb|ACU30249.1| ATP synthase subunit 9, partial (mitochondrion) [Silene laeta] gb|ACU30251.1| ATP synthase subunit 9, partial (mitochondrion) [Petrocoptis pyrenaica] gb|ACU30252.1| ATP synthase subunit 9, partial (mitochondrion) [Silene acutifolia] gb|ACU30253.1| ATP synthase subunit 9, partial (mitochondrion) [Silene akinfievii] gb|ACU30261.1| ATP synthase subunit 9, partial (mitochondrion) [Silene cordifolia] gb|ACU30269.1| ATP synthase subunit 9, partial (mitochondrion) [Silene hookeri] gb|ACU30271.1| ATP synthase subunit 9, partial (mitochondrion) [Silene integripetala] gb|ACU30273.1| ATP synthase subunit 9, partial (mitochondrion) [Silene khasiana] gb|ACU30274.1| ATP synthase subunit 9, partial (mitochondrion) [Silene lacera] gb|ACU30278.1| ATP synthase subunit 9, partial (mitochondrion) [Silene menziesii] gb|ACU30292.1| ATP synthase subunit 9, partial (mitochondrion) [Silene sordida] Length = 56 Score = 65.1 bits (157), Expect = 5e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 221 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 126 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 18 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 49 >gb|ABV25236.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ACU30296.1| ATP synthase subunit 9, partial (mitochondrion) [Silene uniflora] Length = 56 Score = 65.1 bits (157), Expect = 5e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 221 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 126 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 18 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 49 >gb|ABV25234.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25235.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25237.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25238.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25239.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25240.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25242.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25243.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25244.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25245.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25246.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25247.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25248.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25249.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25250.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25251.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25252.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25253.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25254.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25255.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25256.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25258.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25260.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25261.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25262.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25263.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25264.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25265.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25266.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25267.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25268.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25269.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25270.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25271.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25272.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25273.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25302.1| ATP synthase subunit 9, partial (mitochondrion) [Silene acaulis] gb|ABV25304.1| ATP synthase subunit 9, partial (mitochondrion) [Silene paradoxa] gb|ABV25305.1| ATP synthase subunit 9, partial (mitochondrion) [Silene stellata] gb|ABV25306.1| ATP synthase subunit 9, partial (mitochondrion) [Silene coronaria] gb|ACU30248.1| ATP synthase subunit 9, partial (mitochondrion) [Atocion lerchenfeldianum] gb|ACU30250.1| ATP synthase subunit 9, partial (mitochondrion) [Heliosperma pusillum] gb|ACU30256.1| ATP synthase subunit 9, partial (mitochondrion) [Silene argentina] gb|ACU30257.1| ATP synthase subunit 9, partial (mitochondrion) [Silene auriculata] gb|ACU30258.1| ATP synthase subunit 9, partial (mitochondrion) [Silene caesia] gb|ACU30262.1| ATP synthase subunit 9, partial (mitochondrion) [Silene davidii] gb|ACU30264.1| ATP synthase subunit 9, partial (mitochondrion) [Silene dichotoma] gb|ACU30265.1| ATP synthase subunit 9, partial (mitochondrion) [Silene douglasii] gb|ACU30266.1| ATP synthase subunit 9, partial (mitochondrion) [Silene flavescens] gb|ACU30267.1| ATP synthase subunit 9, partial (mitochondrion) [Silene fruticosa] gb|ACU30272.1| ATP synthase subunit 9, partial (mitochondrion) [Silene involucrata] gb|ACU30275.1| ATP synthase subunit 9, partial (mitochondrion) [Silene laciniata] gb|ACU30276.1| ATP synthase subunit 9, partial (mitochondrion) [Silene littorea] gb|ACU30279.1| ATP synthase subunit 9, partial (mitochondrion) [Silene multicaulis] gb|ACU30280.1| ATP synthase subunit 9, partial (mitochondrion) [Silene muscipula] gb|ACU30283.1| ATP synthase subunit 9, partial (mitochondrion) [Silene odontopetala] gb|ACU30284.1| ATP synthase subunit 9, partial (mitochondrion) [Silene paradoxa] gb|ACU30285.1| ATP synthase subunit 9, partial (mitochondrion) [Silene paucifolia] gb|ACU30288.1| ATP synthase subunit 9, partial (mitochondrion) [Silene sachalinensis] gb|ACU30291.1| ATP synthase subunit 9, partial (mitochondrion) [Silene seoulensis] gb|ACU30298.1| ATP synthase subunit 9, partial (mitochondrion) [Silene yemensis] gb|ACU30299.1| ATP synthase subunit 9, partial (mitochondrion) [Silene zawadskii] gb|ACU30300.1| ATP synthase subunit 9, partial (mitochondrion) [Viscaria alpina] Length = 56 Score = 65.1 bits (157), Expect = 5e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 221 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 126 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 18 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 49 >gb|AAW30248.1| ATP synthase F0 subunit 9, partial (mitochondrion) [Aloe vera] Length = 59 Score = 65.1 bits (157), Expect = 6e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 221 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 126 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 18 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 49 >gb|AAW30242.1| ATP synthase F0 subunit 9, partial (mitochondrion) [Piper betle] Length = 59 Score = 65.1 bits (157), Expect = 6e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 221 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 126 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 18 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 49 >gb|EEF22810.1| ATP synthase 9 mitochondrial, putative, partial [Ricinus communis] Length = 61 Score = 65.1 bits (157), Expect = 6e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 221 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 126 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 26 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 57 >gb|KRX85853.1| ATP synthase subunit 9, mitochondrial, partial [Trichinella patagoniensis] Length = 65 Score = 65.1 bits (157), Expect = 7e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 221 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 126 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 19 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 50 >gb|ABH09172.1| ATP synthase subunit 9 (mitochondrion) [Silene uniflora] Length = 70 Score = 65.1 bits (157), Expect = 8e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 221 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 126 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 26 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 57 >gb|ABH09164.1| ATP synthase subunit 9 (mitochondrion) [Silene vulgaris] gb|ABH09166.1| ATP synthase subunit 9 (mitochondrion) [Silene vulgaris] gb|ABH09168.1| ATP synthase subunit 9 (mitochondrion) [Silene vulgaris] gb|ABH09171.1| ATP synthase subunit 9 (mitochondrion) [Silene vulgaris] Length = 70 Score = 65.1 bits (157), Expect = 8e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 221 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 126 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 26 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 57 >gb|ABH09165.1| ATP synthase subunit 9 (mitochondrion) [Silene vulgaris] gb|ABH09167.1| ATP synthase subunit 9 (mitochondrion) [Silene vulgaris] Length = 70 Score = 65.1 bits (157), Expect = 8e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 221 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 126 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 26 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 57 >gb|ABH09169.1| ATP synthase subunit 9 (mitochondrion) [Silene vulgaris] gb|ABH09173.1| ATP synthase subunit 9 (mitochondrion) [Silene latifolia] Length = 70 Score = 65.1 bits (157), Expect = 8e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 221 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 126 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 26 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 57 >gb|ANY30660.1| ATPase subunit 9, partial (mitochondrion) [Halodule wrightii] Length = 72 Score = 65.1 bits (157), Expect = 8e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 221 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 126 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 24 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 55