BLASTX nr result
ID: Rehmannia30_contig00019050
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00019050 (1028 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020547849.1| putative late blight resistance protein homo... 60 4e-06 >ref|XP_020547849.1| putative late blight resistance protein homolog R1A-3 [Sesamum indicum] Length = 903 Score = 60.1 bits (144), Expect = 4e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -1 Query: 479 LGELLYKSLSGMRYLIIMDDLLRVEAWDNIKFFIPD 372 LGE+LYKSL+G RYLIIMDD+ +EAWDN+K F P+ Sbjct: 248 LGEMLYKSLAGKRYLIIMDDMWSIEAWDNVKLFFPN 283