BLASTX nr result
ID: Rehmannia30_contig00018963
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00018963 (455 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN14857.1| putative coiled-coil protein [Handroanthus impeti... 68 5e-11 ref|XP_011101628.1| multiple myeloma tumor-associated protein 2 ... 62 1e-08 >gb|PIN14857.1| putative coiled-coil protein [Handroanthus impetiginosus] Length = 220 Score = 68.2 bits (165), Expect = 5e-11 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = +3 Query: 3 AEVHGLGFARGSRSLEESNLPSGLKTESVENMNANMPTSSARN 131 A+VHGLGFARGSRSLEE +LPS LK+ESVE MNA++PT+S N Sbjct: 125 AQVHGLGFARGSRSLEEPSLPSSLKSESVEKMNASLPTTSTMN 167 >ref|XP_011101628.1| multiple myeloma tumor-associated protein 2 homolog [Sesamum indicum] Length = 216 Score = 62.0 bits (149), Expect = 1e-08 Identities = 29/43 (67%), Positives = 37/43 (86%) Frame = +3 Query: 3 AEVHGLGFARGSRSLEESNLPSGLKTESVENMNANMPTSSARN 131 A+VHGLGF+RG R EES++PS LK+E VENMN ++PT+SARN Sbjct: 124 AQVHGLGFSRGPRPSEESSVPSILKSEPVENMNISVPTTSARN 166