BLASTX nr result
ID: Rehmannia30_contig00018335
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00018335 (465 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011090579.1| pentatricopeptide repeat-containing protein ... 143 1e-36 ref|XP_012845324.1| PREDICTED: pentatricopeptide repeat-containi... 140 9e-36 ref|XP_022851327.1| pentatricopeptide repeat-containing protein ... 126 9e-31 ref|XP_019164881.1| PREDICTED: pentatricopeptide repeat-containi... 119 2e-28 ref|XP_010025494.1| PREDICTED: pentatricopeptide repeat-containi... 116 3e-27 gb|OVA12947.1| Pentatricopeptide repeat [Macleaya cordata] 114 1e-26 ref|XP_016441968.1| PREDICTED: pentatricopeptide repeat-containi... 113 3e-26 ref|XP_009608343.1| PREDICTED: pentatricopeptide repeat-containi... 113 3e-26 ref|XP_019224230.1| PREDICTED: pentatricopeptide repeat-containi... 113 5e-26 ref|XP_009779325.1| PREDICTED: pentatricopeptide repeat-containi... 111 2e-25 gb|POE78818.1| pentatricopeptide repeat-containing protein [Quer... 110 2e-25 ref|XP_023878105.1| pentatricopeptide repeat-containing protein ... 110 4e-25 gb|KZN10406.1| hypothetical protein DCAR_003062 [Daucus carota s... 108 2e-24 ref|XP_017219412.1| PREDICTED: pentatricopeptide repeat-containi... 108 2e-24 gb|KDO43922.1| hypothetical protein CISIN_1g003937mg [Citrus sin... 108 3e-24 gb|PON34569.1| DYW domain containing protein [Trema orientalis] 107 4e-24 dbj|GAY61461.1| hypothetical protein CUMW_210180 [Citrus unshiu] 106 9e-24 ref|XP_006428089.1| pentatricopeptide repeat-containing protein ... 106 9e-24 ref|XP_010258546.1| PREDICTED: pentatricopeptide repeat-containi... 105 2e-23 ref|XP_024180726.1| pentatricopeptide repeat-containing protein ... 105 2e-23 >ref|XP_011090579.1| pentatricopeptide repeat-containing protein At2g22070 [Sesamum indicum] ref|XP_011090580.1| pentatricopeptide repeat-containing protein At2g22070 [Sesamum indicum] ref|XP_011090581.1| pentatricopeptide repeat-containing protein At2g22070 [Sesamum indicum] ref|XP_011090582.1| pentatricopeptide repeat-containing protein At2g22070 [Sesamum indicum] ref|XP_011090583.1| pentatricopeptide repeat-containing protein At2g22070 [Sesamum indicum] ref|XP_011090584.1| pentatricopeptide repeat-containing protein At2g22070 [Sesamum indicum] ref|XP_011090585.1| pentatricopeptide repeat-containing protein At2g22070 [Sesamum indicum] ref|XP_011090588.1| pentatricopeptide repeat-containing protein At2g22070 [Sesamum indicum] ref|XP_011090591.1| pentatricopeptide repeat-containing protein At2g22070 [Sesamum indicum] ref|XP_020552368.1| pentatricopeptide repeat-containing protein At2g22070 [Sesamum indicum] ref|XP_020552369.1| pentatricopeptide repeat-containing protein At2g22070 [Sesamum indicum] ref|XP_020552370.1| pentatricopeptide repeat-containing protein At2g22070 [Sesamum indicum] ref|XP_020552371.1| pentatricopeptide repeat-containing protein At2g22070 [Sesamum indicum] Length = 783 Score = 143 bits (360), Expect = 1e-36 Identities = 78/122 (63%), Positives = 87/122 (71%), Gaps = 25/122 (20%) Frame = -1 Query: 291 MQNPPPRRSQVDLYASILQTSLKTRNPFSIRPIHARIIKSGLQLGVFMMNNVMNAYAKTE 112 MQNPPP SQVDLYASILQTSLKT++ +I+PIHARI+KSGL LGVF+MNN+MNAYAKT Sbjct: 1 MQNPPPPTSQVDLYASILQTSLKTKSLSAIKPIHARIVKSGLHLGVFLMNNLMNAYAKTG 60 Query: 111 FISDARHVFDEMPVRNVSSYNTLLSAYAKQ-------------------------VGYNQ 7 F+SDAR VFD M V+NVSSYNTLLSA AKQ VGYNQ Sbjct: 61 FVSDARRVFDGMSVKNVSSYNTLLSACAKQGMIREALCIFNEVPEPDSVSWTAMIVGYNQ 120 Query: 6 MG 1 MG Sbjct: 121 MG 122 >ref|XP_012845324.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Erythranthe guttata] gb|EYU31065.1| hypothetical protein MIMGU_mgv1a025575mg [Erythranthe guttata] Length = 783 Score = 140 bits (354), Expect = 9e-36 Identities = 66/90 (73%), Positives = 80/90 (88%) Frame = -1 Query: 291 MQNPPPRRSQVDLYASILQTSLKTRNPFSIRPIHARIIKSGLQLGVFMMNNVMNAYAKTE 112 M NPPP S+ DLY+SILQT +KT+ PF+++PIHA I+KSGL GVF+MNNVMNAYAK+ Sbjct: 1 MHNPPPCTSKADLYSSILQTGIKTKCPFTVKPIHALILKSGLHFGVFLMNNVMNAYAKSG 60 Query: 111 FISDARHVFDEMPVRNVSSYNTLLSAYAKQ 22 FISDAR+VFD+MPV+NVS+YNTLLSAYAKQ Sbjct: 61 FISDARYVFDKMPVKNVSTYNTLLSAYAKQ 90 >ref|XP_022851327.1| pentatricopeptide repeat-containing protein At2g22070 [Olea europaea var. sylvestris] ref|XP_022851328.1| pentatricopeptide repeat-containing protein At2g22070 [Olea europaea var. sylvestris] Length = 785 Score = 126 bits (317), Expect = 9e-31 Identities = 60/89 (67%), Positives = 72/89 (80%) Frame = -1 Query: 288 QNPPPRRSQVDLYASILQTSLKTRNPFSIRPIHARIIKSGLQLGVFMMNNVMNAYAKTEF 109 Q PP SQ + YAS+LQTSLKT +PF+I+PIH R+IK GL LGV++MNN+MNAYAK F Sbjct: 4 QTPPFSASQTEFYASLLQTSLKTNDPFTIKPIHCRVIKYGLHLGVYLMNNLMNAYAKKGF 63 Query: 108 ISDARHVFDEMPVRNVSSYNTLLSAYAKQ 22 I DA +FDEMP++ SSYNTLLSAYAKQ Sbjct: 64 IRDAHRIFDEMPLKITSSYNTLLSAYAKQ 92 >ref|XP_019164881.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Ipomoea nil] ref|XP_019164882.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Ipomoea nil] Length = 785 Score = 119 bits (299), Expect = 2e-28 Identities = 59/89 (66%), Positives = 72/89 (80%) Frame = -1 Query: 288 QNPPPRRSQVDLYASILQTSLKTRNPFSIRPIHARIIKSGLQLGVFMMNNVMNAYAKTEF 109 QN P S D YAS+LQTSLK ++P +IR IHARIIKSGL LG F++NN++NAY K EF Sbjct: 4 QNSHPMTSLSDFYASLLQTSLKLKDPVAIRSIHARIIKSGLHLGPFLVNNLINAYGKIEF 63 Query: 108 ISDARHVFDEMPVRNVSSYNTLLSAYAKQ 22 ISDA+ +FDEMP R+ SS+NTLLSAYAK+ Sbjct: 64 ISDAQSLFDEMPTRDASSWNTLLSAYAKR 92 >ref|XP_010025494.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Eucalyptus grandis] Length = 786 Score = 116 bits (291), Expect = 3e-27 Identities = 55/90 (61%), Positives = 69/90 (76%) Frame = -1 Query: 291 MQNPPPRRSQVDLYASILQTSLKTRNPFSIRPIHARIIKSGLQLGVFMMNNVMNAYAKTE 112 + NPPP D YA +LQ SLK ++PF+ R +HA+IIKSGL G+F+MNN+MN YAK+E Sbjct: 4 ISNPPPVPCPSDSYAYLLQASLKNKDPFAARSVHAQIIKSGLHFGLFLMNNLMNFYAKSE 63 Query: 111 FISDARHVFDEMPVRNVSSYNTLLSAYAKQ 22 F DAR VFDEMP +N SS+NT+LS YAKQ Sbjct: 64 FRDDARRVFDEMPEKNTSSWNTILSMYAKQ 93 >gb|OVA12947.1| Pentatricopeptide repeat [Macleaya cordata] Length = 788 Score = 114 bits (286), Expect = 1e-26 Identities = 61/119 (51%), Positives = 76/119 (63%), Gaps = 25/119 (21%) Frame = -1 Query: 282 PPPRRSQVDLYASILQTSLKTRNPFSIRPIHARIIKSGLQLGVFMMNNVMNAYAKTEFIS 103 P S D YAS+LQTSLKTR+P + + IHAR+IKSGL LGVF++NN++N YAK+ IS Sbjct: 9 PSTLHSPSDFYASLLQTSLKTRDPIAGKSIHARVIKSGLHLGVFLLNNLINFYAKSGLIS 68 Query: 102 DARHVFDEMPVRNVSSYNTLLSAYAKQ-------------------------VGYNQMG 1 DA +FDEMP++N S+NT+LSAYAKQ VGYNQMG Sbjct: 69 DANRLFDEMPIKNTFSWNTILSAYAKQGRLDTACLIFKEMPERDSVSWTAMIVGYNQMG 127 >ref|XP_016441968.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Nicotiana tabacum] Length = 785 Score = 113 bits (283), Expect = 3e-26 Identities = 56/87 (64%), Positives = 68/87 (78%) Frame = -1 Query: 267 SQVDLYASILQTSLKTRNPFSIRPIHARIIKSGLQLGVFMMNNVMNAYAKTEFISDARHV 88 SQ Y S+LQ SLKT+ PF+I+ IH IIKSGL LGVF+MNN++N YAKT F+S AR V Sbjct: 11 SQSHFYVSLLQDSLKTKKPFAIKLIHGSIIKSGLHLGVFLMNNLINGYAKTGFLSYARKV 70 Query: 87 FDEMPVRNVSSYNTLLSAYAKQVGYNQ 7 FDEMPVR+ SS+NTLLS Y+KQ N+ Sbjct: 71 FDEMPVRDTSSWNTLLSGYSKQGSVNE 97 >ref|XP_009608343.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Nicotiana tomentosiformis] ref|XP_009608346.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Nicotiana tomentosiformis] ref|XP_009608347.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Nicotiana tomentosiformis] ref|XP_009608348.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Nicotiana tomentosiformis] ref|XP_009608349.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Nicotiana tomentosiformis] ref|XP_018628396.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Nicotiana tomentosiformis] Length = 785 Score = 113 bits (283), Expect = 3e-26 Identities = 56/87 (64%), Positives = 68/87 (78%) Frame = -1 Query: 267 SQVDLYASILQTSLKTRNPFSIRPIHARIIKSGLQLGVFMMNNVMNAYAKTEFISDARHV 88 SQ Y S+LQ SLKT+ PF+I+ IH IIKSGL LGVF+MNN++N YAKT F+S AR V Sbjct: 11 SQSHFYVSLLQDSLKTKKPFAIKLIHGSIIKSGLHLGVFLMNNLINGYAKTGFLSYARKV 70 Query: 87 FDEMPVRNVSSYNTLLSAYAKQVGYNQ 7 FDEMPVR+ SS+NTLLS Y+KQ N+ Sbjct: 71 FDEMPVRDTSSWNTLLSGYSKQGSVNE 97 >ref|XP_019224230.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Nicotiana attenuata] ref|XP_019224231.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Nicotiana attenuata] ref|XP_019224232.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Nicotiana attenuata] ref|XP_019224233.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Nicotiana attenuata] Length = 785 Score = 113 bits (282), Expect = 5e-26 Identities = 56/82 (68%), Positives = 66/82 (80%) Frame = -1 Query: 267 SQVDLYASILQTSLKTRNPFSIRPIHARIIKSGLQLGVFMMNNVMNAYAKTEFISDARHV 88 SQ Y S+LQ SLKT+ PFSI+ IH IIKSGL LGVF+MNN++N YAKT F+S AR V Sbjct: 11 SQPHFYVSLLQDSLKTKKPFSIKLIHGSIIKSGLHLGVFLMNNLINGYAKTGFLSYARKV 70 Query: 87 FDEMPVRNVSSYNTLLSAYAKQ 22 FDEMPVR+ SS+NTLLS Y+KQ Sbjct: 71 FDEMPVRDTSSWNTLLSGYSKQ 92 >ref|XP_009779325.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Nicotiana sylvestris] ref|XP_009779326.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Nicotiana sylvestris] ref|XP_009779327.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Nicotiana sylvestris] ref|XP_009779328.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Nicotiana sylvestris] ref|XP_009779329.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Nicotiana sylvestris] ref|XP_016471141.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Nicotiana tabacum] ref|XP_016471142.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Nicotiana tabacum] Length = 785 Score = 111 bits (278), Expect = 2e-25 Identities = 54/82 (65%), Positives = 65/82 (79%) Frame = -1 Query: 267 SQVDLYASILQTSLKTRNPFSIRPIHARIIKSGLQLGVFMMNNVMNAYAKTEFISDARHV 88 SQ Y S+LQ SLKT+ PF+I+ IH I+KSGL GVF+MNNV+N YAKT F+S AR V Sbjct: 11 SQSHFYVSLLQDSLKTKRPFAIKLIHGHIVKSGLHFGVFLMNNVINGYAKTGFLSYARKV 70 Query: 87 FDEMPVRNVSSYNTLLSAYAKQ 22 FDEMPVR+ SS+NTLLS Y+KQ Sbjct: 71 FDEMPVRDTSSWNTLLSGYSKQ 92 >gb|POE78818.1| pentatricopeptide repeat-containing protein [Quercus suber] Length = 474 Score = 110 bits (275), Expect = 2e-25 Identities = 61/119 (51%), Positives = 75/119 (63%), Gaps = 25/119 (21%) Frame = -1 Query: 282 PPPRRSQVDLYASILQTSLKTRNPFSIRPIHARIIKSGLQLGVFMMNNVMNAYAKTEFIS 103 PP S D YA +LQTSLK+++P + + IHARIIK+GL LGVF+MNN+M YAK+ F+S Sbjct: 6 PPFPTSSSDFYAFLLQTSLKSKDPLAGKLIHARIIKAGLHLGVFLMNNLMTFYAKSGFVS 65 Query: 102 DARHVFDEMPVRNVSSYNTLLSAYAKQ-------------------------VGYNQMG 1 DA VFDEM VR + S+NT+LSAYAKQ VGYNQMG Sbjct: 66 DAHRVFDEMNVRTIFSWNTILSAYAKQGRFDKAHRVFEEIPDRDSVSWTTMIVGYNQMG 124 >ref|XP_023878105.1| pentatricopeptide repeat-containing protein At2g22070 [Quercus suber] Length = 785 Score = 110 bits (275), Expect = 4e-25 Identities = 61/119 (51%), Positives = 75/119 (63%), Gaps = 25/119 (21%) Frame = -1 Query: 282 PPPRRSQVDLYASILQTSLKTRNPFSIRPIHARIIKSGLQLGVFMMNNVMNAYAKTEFIS 103 PP S D YA +LQTSLK+++P + + IHARIIK+GL LGVF+MNN+M YAK+ F+S Sbjct: 6 PPFPTSSSDFYAFLLQTSLKSKDPLAGKLIHARIIKAGLHLGVFLMNNLMTFYAKSGFVS 65 Query: 102 DARHVFDEMPVRNVSSYNTLLSAYAKQ-------------------------VGYNQMG 1 DA VFDEM VR + S+NT+LSAYAKQ VGYNQMG Sbjct: 66 DAHRVFDEMNVRTIFSWNTILSAYAKQGRFDKAHRVFEEIPDRDSVSWTTMIVGYNQMG 124 >gb|KZN10406.1| hypothetical protein DCAR_003062 [Daucus carota subsp. sativus] Length = 645 Score = 108 bits (270), Expect = 2e-24 Identities = 52/82 (63%), Positives = 65/82 (79%) Frame = -1 Query: 267 SQVDLYASILQTSLKTRNPFSIRPIHARIIKSGLQLGVFMMNNVMNAYAKTEFISDARHV 88 SQ Y S+LQ SL+ +PF+ + +H RIIKSGL L VF+MNN++N YAKT F+SDA + Sbjct: 11 SQSYYYTSLLQWSLRNNDPFTAKLVHVRIIKSGLHLSVFLMNNLLNVYAKTGFLSDAHRM 70 Query: 87 FDEMPVRNVSSYNTLLSAYAKQ 22 FDEMPV+N SS+NTLLSAYAKQ Sbjct: 71 FDEMPVKNPSSWNTLLSAYAKQ 92 >ref|XP_017219412.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 isoform X1 [Daucus carota subsp. sativus] ref|XP_017219495.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 isoform X2 [Daucus carota subsp. sativus] Length = 785 Score = 108 bits (270), Expect = 2e-24 Identities = 52/82 (63%), Positives = 65/82 (79%) Frame = -1 Query: 267 SQVDLYASILQTSLKTRNPFSIRPIHARIIKSGLQLGVFMMNNVMNAYAKTEFISDARHV 88 SQ Y S+LQ SL+ +PF+ + +H RIIKSGL L VF+MNN++N YAKT F+SDA + Sbjct: 11 SQSYYYTSLLQWSLRNNDPFTAKLVHVRIIKSGLHLSVFLMNNLLNVYAKTGFLSDAHRM 70 Query: 87 FDEMPVRNVSSYNTLLSAYAKQ 22 FDEMPV+N SS+NTLLSAYAKQ Sbjct: 71 FDEMPVKNPSSWNTLLSAYAKQ 92 >gb|KDO43922.1| hypothetical protein CISIN_1g003937mg [Citrus sinensis] Length = 785 Score = 108 bits (269), Expect = 3e-24 Identities = 53/88 (60%), Positives = 69/88 (78%) Frame = -1 Query: 285 NPPPRRSQVDLYASILQTSLKTRNPFSIRPIHARIIKSGLQLGVFMMNNVMNAYAKTEFI 106 NPP S ++ YA +LQ++LK+RNPF + +HARIIK GL L VF+ N++MN YAKTE I Sbjct: 5 NPPSLISPLEFYAHLLQSNLKSRNPFVGKLVHARIIKCGLHLSVFLKNSLMNFYAKTESI 64 Query: 105 SDARHVFDEMPVRNVSSYNTLLSAYAKQ 22 S A+ VFDEMPV+ + S+NT+LSAYAKQ Sbjct: 65 SYAKKVFDEMPVKTLCSWNTILSAYAKQ 92 >gb|PON34569.1| DYW domain containing protein [Trema orientalis] Length = 829 Score = 107 bits (268), Expect = 4e-24 Identities = 61/119 (51%), Positives = 71/119 (59%), Gaps = 25/119 (21%) Frame = -1 Query: 282 PPPRRSQVDLYASILQTSLKTRNPFSIRPIHARIIKSGLQLGVFMMNNVMNAYAKTEFIS 103 PPP D YA LQTSLK R+P S + IHARIIK+GL +GVF+MNN+M YAKT +S Sbjct: 50 PPPPTFPSDFYAYHLQTSLKARDPLSGKSIHARIIKAGLHMGVFLMNNLMTFYAKTGSLS 109 Query: 102 DARHVFDEMPVRNVSSYNTLLSAYAKQ-------------------------VGYNQMG 1 +A VFDEMPVR S+N +LSAYAKQ VGYNQMG Sbjct: 110 EAHRVFDEMPVRTKLSWNMILSAYAKQGRFDVALRIFDEMPERDSVSWTAMIVGYNQMG 168 >dbj|GAY61461.1| hypothetical protein CUMW_210180 [Citrus unshiu] Length = 785 Score = 106 bits (265), Expect = 9e-24 Identities = 52/88 (59%), Positives = 68/88 (77%) Frame = -1 Query: 285 NPPPRRSQVDLYASILQTSLKTRNPFSIRPIHARIIKSGLQLGVFMMNNVMNAYAKTEFI 106 NPP S ++ YA +LQ++LK+RNPF + +H RIIK GL L VF+ N++MN YAKTE I Sbjct: 5 NPPSLISPLEFYAHLLQSNLKSRNPFVGKLVHVRIIKCGLHLSVFLKNSLMNFYAKTESI 64 Query: 105 SDARHVFDEMPVRNVSSYNTLLSAYAKQ 22 S A+ VFDEMPV+ + S+NT+LSAYAKQ Sbjct: 65 SYAKKVFDEMPVKTLCSWNTILSAYAKQ 92 >ref|XP_006428089.1| pentatricopeptide repeat-containing protein At2g22070 [Citrus clementina] ref|XP_006464311.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Citrus sinensis] ref|XP_015386583.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Citrus sinensis] gb|ESR41329.1| hypothetical protein CICLE_v10027512mg [Citrus clementina] Length = 785 Score = 106 bits (265), Expect = 9e-24 Identities = 52/88 (59%), Positives = 68/88 (77%) Frame = -1 Query: 285 NPPPRRSQVDLYASILQTSLKTRNPFSIRPIHARIIKSGLQLGVFMMNNVMNAYAKTEFI 106 NPP S ++ YA +LQ++LK+RNPF + +H RIIK GL L VF+ N++MN YAKTE I Sbjct: 5 NPPSLISPLEFYAHLLQSNLKSRNPFVGKLVHVRIIKCGLHLSVFLKNSLMNFYAKTESI 64 Query: 105 SDARHVFDEMPVRNVSSYNTLLSAYAKQ 22 S A+ VFDEMPV+ + S+NT+LSAYAKQ Sbjct: 65 SYAKKVFDEMPVKTLCSWNTILSAYAKQ 92 >ref|XP_010258546.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Nelumbo nucifera] Length = 790 Score = 105 bits (263), Expect = 2e-23 Identities = 52/87 (59%), Positives = 66/87 (75%) Frame = -1 Query: 282 PPPRRSQVDLYASILQTSLKTRNPFSIRPIHARIIKSGLQLGVFMMNNVMNAYAKTEFIS 103 PP S D YA++LQTSLKT P + + IHARIIK+GL LGVF+ NN++N YAK +S Sbjct: 11 PPSFFSPSDFYATLLQTSLKTNIPIAGKSIHARIIKTGLHLGVFLTNNLINFYAKAGSVS 70 Query: 102 DARHVFDEMPVRNVSSYNTLLSAYAKQ 22 DA +FDEMP++N S+NT+LSAYAKQ Sbjct: 71 DAHKLFDEMPLKNTFSWNTILSAYAKQ 97 >ref|XP_024180726.1| pentatricopeptide repeat-containing protein At2g22070 [Rosa chinensis] ref|XP_024180727.1| pentatricopeptide repeat-containing protein At2g22070 [Rosa chinensis] ref|XP_024180728.1| pentatricopeptide repeat-containing protein At2g22070 [Rosa chinensis] ref|XP_024180729.1| pentatricopeptide repeat-containing protein At2g22070 [Rosa chinensis] ref|XP_024180730.1| pentatricopeptide repeat-containing protein At2g22070 [Rosa chinensis] gb|PRQ48905.1| putative tetratricopeptide-like helical domain, DYW domain-containing protein [Rosa chinensis] Length = 783 Score = 105 bits (262), Expect = 2e-23 Identities = 60/122 (49%), Positives = 71/122 (58%), Gaps = 25/122 (20%) Frame = -1 Query: 291 MQNPPPRRSQVDLYASILQTSLKTRNPFSIRPIHARIIKSGLQLGVFMMNNVMNAYAKTE 112 M+ P P + D YA LQ L R+PF+ + IHA+IIKSGL LGVF+MNN+MN Y KT Sbjct: 1 MEAPNPLTTSSDFYAYHLQACLNKRHPFAGKSIHAQIIKSGLHLGVFLMNNLMNYYIKTG 60 Query: 111 FISDARHVFDEMPVRNVSSYNTLLSAYAKQ-------------------------VGYNQ 7 DAR+VFDEMPVRN S+NT+LS Y KQ VGYNQ Sbjct: 61 SYVDARNVFDEMPVRNKFSWNTILSGYTKQGRLDAAWGVFNEMPERDSVSWTAMIVGYNQ 120 Query: 6 MG 1 MG Sbjct: 121 MG 122