BLASTX nr result
ID: Rehmannia30_contig00018069
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00018069 (399 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022876971.1| calcium-dependent protein kinase 21-like [Ol... 69 8e-12 ref|XP_023002935.1| calcium-dependent protein kinase 21-like [Cu... 71 1e-11 ref|XP_023517514.1| calcium-dependent protein kinase 21-like [Cu... 71 1e-11 ref|XP_022926931.1| calcium-dependent protein kinase 21-like iso... 71 1e-11 ref|XP_022142200.1| calcium-dependent protein kinase 21-like [Mo... 71 1e-11 ref|XP_022926930.1| calcium-dependent protein kinase 21-like iso... 71 1e-11 ref|XP_011086186.1| calcium-dependent protein kinase [Sesamum in... 71 1e-11 gb|PIN08573.1| Ca2+/calmodulin-dependent protein kinase, EF-Hand... 70 2e-11 ref|XP_023543712.1| calcium-dependent protein kinase 2-like [Cuc... 70 2e-11 ref|XP_022978862.1| calcium-dependent protein kinase 2-like [Cuc... 70 2e-11 ref|XP_022950188.1| calcium-dependent protein kinase 21-like [Cu... 70 2e-11 ref|XP_008439982.1| PREDICTED: calcium-dependent protein kinase ... 70 2e-11 ref|XP_004134759.1| PREDICTED: calcium-dependent protein kinase ... 70 2e-11 ref|XP_012841982.1| PREDICTED: calcium-dependent protein kinase-... 69 5e-11 emb|CDP05759.1| unnamed protein product [Coffea canephora] 69 6e-11 ref|XP_011096067.1| calcium-dependent protein kinase [Sesamum in... 69 6e-11 ref|XP_010686845.1| PREDICTED: calcium-dependent protein kinase ... 69 6e-11 ref|XP_022877975.1| calcium-dependent protein kinase-like isofor... 69 8e-11 ref|XP_022877974.1| calcium-dependent protein kinase-like isofor... 69 9e-11 ref|XP_008345823.1| PREDICTED: calcium-dependent protein kinase ... 64 9e-11 >ref|XP_022876971.1| calcium-dependent protein kinase 21-like [Olea europaea var. sylvestris] Length = 165 Score = 68.6 bits (166), Expect = 8e-12 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -1 Query: 399 IKEIISEVDTDNDGKINYEEFCAMMRSGTTQPLKLF 292 IKEIISEVDTDNDG+INYEEFC MMRSGTTQ KLF Sbjct: 130 IKEIISEVDTDNDGRINYEEFCQMMRSGTTQQAKLF 165 >ref|XP_023002935.1| calcium-dependent protein kinase 21-like [Cucurbita maxima] Length = 549 Score = 71.2 bits (173), Expect = 1e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -1 Query: 399 IKEIISEVDTDNDGKINYEEFCAMMRSGTTQPLKLF 292 IKEIISEVDTDNDG+INY+EFCAMMRSGTTQP KLF Sbjct: 514 IKEIISEVDTDNDGRINYQEFCAMMRSGTTQPGKLF 549 >ref|XP_023517514.1| calcium-dependent protein kinase 21-like [Cucurbita pepo subsp. pepo] Length = 550 Score = 71.2 bits (173), Expect = 1e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -1 Query: 399 IKEIISEVDTDNDGKINYEEFCAMMRSGTTQPLKLF 292 IKEIISEVDTDNDG+INY+EFCAMMRSGTTQP KLF Sbjct: 515 IKEIISEVDTDNDGRINYQEFCAMMRSGTTQPGKLF 550 >ref|XP_022926931.1| calcium-dependent protein kinase 21-like isoform X2 [Cucurbita moschata] Length = 551 Score = 71.2 bits (173), Expect = 1e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -1 Query: 399 IKEIISEVDTDNDGKINYEEFCAMMRSGTTQPLKLF 292 IKEIISEVDTDNDG+INY+EFCAMMRSGTTQP KLF Sbjct: 516 IKEIISEVDTDNDGRINYQEFCAMMRSGTTQPGKLF 551 >ref|XP_022142200.1| calcium-dependent protein kinase 21-like [Momordica charantia] Length = 556 Score = 71.2 bits (173), Expect = 1e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -1 Query: 399 IKEIISEVDTDNDGKINYEEFCAMMRSGTTQPLKLF 292 IKEIISEVDTDNDG+INY+EFCAMMRSGTTQP KLF Sbjct: 521 IKEIISEVDTDNDGRINYQEFCAMMRSGTTQPGKLF 556 >ref|XP_022926930.1| calcium-dependent protein kinase 21-like isoform X1 [Cucurbita moschata] Length = 578 Score = 71.2 bits (173), Expect = 1e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -1 Query: 399 IKEIISEVDTDNDGKINYEEFCAMMRSGTTQPLKLF 292 IKEIISEVDTDNDG+INY+EFCAMMRSGTTQP KLF Sbjct: 543 IKEIISEVDTDNDGRINYQEFCAMMRSGTTQPGKLF 578 >ref|XP_011086186.1| calcium-dependent protein kinase [Sesamum indicum] Length = 543 Score = 70.9 bits (172), Expect = 1e-11 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -1 Query: 399 IKEIISEVDTDNDGKINYEEFCAMMRSGTTQPLKLF 292 IKEIISEVDTDNDG+INY+EFCAMMRSGT QP+KLF Sbjct: 508 IKEIISEVDTDNDGRINYDEFCAMMRSGTQQPVKLF 543 >gb|PIN08573.1| Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Handroanthus impetiginosus] Length = 536 Score = 70.1 bits (170), Expect = 2e-11 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -1 Query: 399 IKEIISEVDTDNDGKINYEEFCAMMRSGTTQPLKLF 292 IKEIISEVDTDNDG+INY+EFCAMMRSGTTQ +KLF Sbjct: 501 IKEIISEVDTDNDGRINYDEFCAMMRSGTTQQVKLF 536 >ref|XP_023543712.1| calcium-dependent protein kinase 2-like [Cucurbita pepo subsp. pepo] Length = 551 Score = 70.1 bits (170), Expect = 2e-11 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -1 Query: 399 IKEIISEVDTDNDGKINYEEFCAMMRSGTTQPLKLF 292 I+EIISEVDTDNDG+INY+EFCAMMRSGTTQP KLF Sbjct: 516 IREIISEVDTDNDGRINYQEFCAMMRSGTTQPGKLF 551 >ref|XP_022978862.1| calcium-dependent protein kinase 2-like [Cucurbita maxima] Length = 551 Score = 70.1 bits (170), Expect = 2e-11 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -1 Query: 399 IKEIISEVDTDNDGKINYEEFCAMMRSGTTQPLKLF 292 I+EIISEVDTDNDG+INY+EFCAMMRSGTTQP KLF Sbjct: 516 IREIISEVDTDNDGRINYQEFCAMMRSGTTQPGKLF 551 >ref|XP_022950188.1| calcium-dependent protein kinase 21-like [Cucurbita moschata] Length = 551 Score = 70.1 bits (170), Expect = 2e-11 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -1 Query: 399 IKEIISEVDTDNDGKINYEEFCAMMRSGTTQPLKLF 292 I+EIISEVDTDNDG+INY+EFCAMMRSGTTQP KLF Sbjct: 516 IREIISEVDTDNDGRINYQEFCAMMRSGTTQPGKLF 551 >ref|XP_008439982.1| PREDICTED: calcium-dependent protein kinase 2 [Cucumis melo] Length = 552 Score = 70.1 bits (170), Expect = 2e-11 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -1 Query: 399 IKEIISEVDTDNDGKINYEEFCAMMRSGTTQPLKLF 292 I+EIISEVDTDNDG+INY+EFCAMMRSGTTQP KLF Sbjct: 517 IREIISEVDTDNDGRINYQEFCAMMRSGTTQPGKLF 552 >ref|XP_004134759.1| PREDICTED: calcium-dependent protein kinase 2-like [Cucumis sativus] gb|KGN49114.1| hypothetical protein Csa_6G513780 [Cucumis sativus] Length = 552 Score = 70.1 bits (170), Expect = 2e-11 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -1 Query: 399 IKEIISEVDTDNDGKINYEEFCAMMRSGTTQPLKLF 292 I+EIISEVDTDNDG+INY+EFCAMMRSGTTQP KLF Sbjct: 517 IREIISEVDTDNDGRINYQEFCAMMRSGTTQPGKLF 552 >ref|XP_012841982.1| PREDICTED: calcium-dependent protein kinase-like [Erythranthe guttata] gb|EYU33891.1| hypothetical protein MIMGU_mgv1a004201mg [Erythranthe guttata] Length = 539 Score = 69.3 bits (168), Expect = 5e-11 Identities = 34/37 (91%), Positives = 36/37 (97%), Gaps = 1/37 (2%) Frame = -1 Query: 399 IKEIISEVDTDNDGKINYEEFCAMMRSGTTQP-LKLF 292 I+EIISEVDTDNDGKINYEEFCAMMRSGTTQP +KLF Sbjct: 503 IEEIISEVDTDNDGKINYEEFCAMMRSGTTQPAVKLF 539 >emb|CDP05759.1| unnamed protein product [Coffea canephora] Length = 520 Score = 68.9 bits (167), Expect = 6e-11 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -1 Query: 399 IKEIISEVDTDNDGKINYEEFCAMMRSGTTQPLKLF 292 IKEIISEVDTDNDG+INYEEFC MMRSGT QP KLF Sbjct: 485 IKEIISEVDTDNDGRINYEEFCTMMRSGTKQPNKLF 520 >ref|XP_011096067.1| calcium-dependent protein kinase [Sesamum indicum] Length = 541 Score = 68.9 bits (167), Expect = 6e-11 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -1 Query: 399 IKEIISEVDTDNDGKINYEEFCAMMRSGTTQPLKLF 292 IKEIISEVDTDNDG+INYEEFCAMMRSGT Q +KLF Sbjct: 506 IKEIISEVDTDNDGRINYEEFCAMMRSGTQQQVKLF 541 >ref|XP_010686845.1| PREDICTED: calcium-dependent protein kinase 2 [Beta vulgaris subsp. vulgaris] gb|KMT04180.1| hypothetical protein BVRB_8g186280 [Beta vulgaris subsp. vulgaris] Length = 589 Score = 68.9 bits (167), Expect = 6e-11 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -1 Query: 399 IKEIISEVDTDNDGKINYEEFCAMMRSGTTQPLKLF 292 IKEI+SEVDTDNDG+INYEEFC MMRSGTTQ +KLF Sbjct: 554 IKEILSEVDTDNDGRINYEEFCTMMRSGTTQQVKLF 589 >ref|XP_022877975.1| calcium-dependent protein kinase-like isoform X2 [Olea europaea var. sylvestris] Length = 554 Score = 68.6 bits (166), Expect = 8e-11 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -1 Query: 399 IKEIISEVDTDNDGKINYEEFCAMMRSGTTQPLKLF 292 IKEIISEVDTDNDG+INYEEFC MMRSGTTQ KLF Sbjct: 519 IKEIISEVDTDNDGRINYEEFCQMMRSGTTQQAKLF 554 >ref|XP_022877974.1| calcium-dependent protein kinase-like isoform X1 [Olea europaea var. sylvestris] Length = 559 Score = 68.6 bits (166), Expect = 9e-11 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -1 Query: 399 IKEIISEVDTDNDGKINYEEFCAMMRSGTTQPLKLF 292 IKEIISEVDTDNDG+INYEEFC MMRSGTTQ KLF Sbjct: 524 IKEIISEVDTDNDGRINYEEFCQMMRSGTTQQAKLF 559 >ref|XP_008345823.1| PREDICTED: calcium-dependent protein kinase 2-like [Malus domestica] Length = 103 Score = 64.3 bits (155), Expect = 9e-11 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -1 Query: 399 IKEIISEVDTDNDGKINYEEFCAMMRSGTTQPLKLF 292 I+EIISEVD DNDG+INY EFCAMMRSG QP KLF Sbjct: 68 IREIISEVDADNDGRINYSEFCAMMRSGAQQPAKLF 103