BLASTX nr result
ID: Rehmannia30_contig00017398
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00017398 (435 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZV23926.1| transcription factor TFIIIB component B'' [Dorcoc... 42 1e-06 >gb|KZV23926.1| transcription factor TFIIIB component B'' [Dorcoceras hygrometricum] Length = 687 Score = 42.4 bits (98), Expect(3) = 1e-06 Identities = 17/29 (58%), Positives = 24/29 (82%) Frame = +3 Query: 345 QNANIFIELEALGDFLPHTYSDMECTVPP 431 +N +IFI L++L DF+PHT SD+E T+PP Sbjct: 119 ENTDIFIGLDSLDDFIPHTASDIEGTIPP 147 Score = 28.5 bits (62), Expect(3) = 1e-06 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +1 Query: 226 PNVKGAWHSFIEKSAGE 276 PN G WHS +EKS GE Sbjct: 103 PNDSGGWHSCMEKSLGE 119 Score = 28.1 bits (61), Expect(3) = 1e-06 Identities = 18/58 (31%), Positives = 23/58 (39%) Frame = +2 Query: 65 AKFRPTRKEXXXXXXXXXXXXXXIDSTQSELSEPVGTAKPSYQRTIMVSGSDACLTSK 238 AK RP R + ++ +SELSEP KPS GS+ L K Sbjct: 30 AKLRPPRNDSTPTLSSSSGAALINEAVESELSEPATFTKPSAHDDKWNCGSECFLDEK 87