BLASTX nr result
ID: Rehmannia30_contig00017187
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00017187 (619 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PPZ30776.1| hypothetical protein C5P26_27090, partial [Escher... 54 5e-06 >gb|PPZ30776.1| hypothetical protein C5P26_27090, partial [Escherichia coli] Length = 108 Score = 53.9 bits (128), Expect = 5e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = +1 Query: 526 ICPYLFILIIDEITKHLQKSIPECMLFADDI 618 I PYLF L++DE+TKH+Q+SIP CM+FADDI Sbjct: 11 ISPYLFTLVLDELTKHIQESIPWCMMFADDI 41