BLASTX nr result
ID: Rehmannia30_contig00017091
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00017091 (401 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011072776.1| probable mitochondrial adenine nucleotide tr... 92 3e-19 ref|XP_012856539.1| PREDICTED: probable mitochondrial adenine nu... 80 4e-15 gb|PIN23891.1| Mitochondrial solute carrier protein [Handroanthu... 59 1e-07 >ref|XP_011072776.1| probable mitochondrial adenine nucleotide transporter BTL1 [Sesamum indicum] Length = 370 Score = 91.7 bits (226), Expect = 3e-19 Identities = 46/63 (73%), Positives = 49/63 (77%) Frame = -2 Query: 190 MIQKTPAKNQRRHQKKSYCFMEDIYGVMMVPKEELQFQLQPDSLSFKKPSPLHLLVHVPD 11 MIQKTPA+ Q HQKKSYC MEDIYGVMMVPK ELQ QLQ SLS KK SP HL + PD Sbjct: 1 MIQKTPAQTQHHHQKKSYCVMEDIYGVMMVPK-ELQLQLQLHSLSHKKSSPFHLQLRAPD 59 Query: 10 IGR 2 +GR Sbjct: 60 LGR 62 >ref|XP_012856539.1| PREDICTED: probable mitochondrial adenine nucleotide transporter BTL1 [Erythranthe guttata] Length = 376 Score = 80.5 bits (197), Expect = 4e-15 Identities = 40/63 (63%), Positives = 47/63 (74%) Frame = -2 Query: 190 MIQKTPAKNQRRHQKKSYCFMEDIYGVMMVPKEELQFQLQPDSLSFKKPSPLHLLVHVPD 11 MIQKTP + Q+R QK SYC MEDIYGV +VPKE+LQ QLQ L +KPSP L + VPD Sbjct: 1 MIQKTPTQTQQRLQKNSYCIMEDIYGVTVVPKEDLQLQLQ---LQPQKPSPFRLKLRVPD 57 Query: 10 IGR 2 +GR Sbjct: 58 VGR 60 >gb|PIN23891.1| Mitochondrial solute carrier protein [Handroanthus impetiginosus] Length = 349 Score = 59.3 bits (142), Expect = 1e-07 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = -2 Query: 130 MEDIYGVMMVPKEELQFQLQPDSLSFKKPSPLHLLVHVPDIGR 2 MEDIYGVMMVPKEELQ QL+ S+S K SP LL+ PD+GR Sbjct: 1 MEDIYGVMMVPKEELQLQLKLHSVSDNKSSPFQLLLPFPDVGR 43