BLASTX nr result
ID: Rehmannia30_contig00016545
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00016545 (643 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNX54314.1| laccase-17-like protein, partial [Trifolium prate... 60 4e-09 gb|EXB77141.1| hypothetical protein L484_002029 [Morus notabilis] 62 8e-09 ref|XP_022887365.1| laccase-4-like [Olea europaea var. sylvestris] 65 1e-08 gb|PRQ43239.1| putative laccase [Rosa chinensis] 62 1e-08 ref|XP_022846645.1| laccase-2-like [Olea europaea var. sylvestris] 65 1e-08 ref|XP_022971457.1| LOW QUALITY PROTEIN: laccase-17-like [Cucurb... 64 2e-08 ref|XP_010106521.1| laccase-2 [Morus notabilis] >gi|587923347|gb... 64 2e-08 ref|XP_008240736.1| PREDICTED: laccase-17-like [Prunus mume] 64 2e-08 gb|AFK35326.1| unknown [Medicago truncatula] 62 3e-08 gb|EYU41740.1| hypothetical protein MIMGU_mgv1a026682mg [Erythra... 64 3e-08 gb|PIN04756.1| Multicopper oxidase [Handroanthus impetiginosus] 64 3e-08 gb|OIT01153.1| laccase-17, partial [Nicotiana attenuata] 64 3e-08 gb|KZV27630.1| laccase-17-like [Dorcoceras hygrometricum] 64 3e-08 ref|XP_023539539.1| laccase-17-like [Cucurbita pepo subsp. pepo] 64 3e-08 ref|XP_020553486.1| laccase-17-like [Sesamum indicum] 64 3e-08 ref|XP_019250476.1| PREDICTED: laccase-17-like [Nicotiana attenu... 64 3e-08 ref|XP_016468710.1| PREDICTED: laccase-17-like [Nicotiana tabacum] 64 3e-08 ref|XP_009760365.1| PREDICTED: laccase-17-like [Nicotiana sylves... 64 3e-08 ref|XP_019186338.1| PREDICTED: laccase-17-like [Ipomoea nil] 64 3e-08 ref|XP_007208011.1| laccase-17 [Prunus persica] >gi|1139768692|g... 64 3e-08 >gb|PNX54314.1| laccase-17-like protein, partial [Trifolium pratense] Length = 43 Score = 60.5 bits (145), Expect = 4e-09 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = -2 Query: 252 GVWFMHCHFDVHTSWGLRMAWIVQDG 175 GVWFMHCH D+HTSWGLRMAW+V DG Sbjct: 1 GVWFMHCHLDIHTSWGLRMAWLVLDG 26 >gb|EXB77141.1| hypothetical protein L484_002029 [Morus notabilis] Length = 113 Score = 61.6 bits (148), Expect = 8e-09 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = -2 Query: 252 GVWFMHCHFDVHTSWGLRMAWIVQDG 175 GVWFMHCHFDVH SWGLRMAWIV DG Sbjct: 71 GVWFMHCHFDVHLSWGLRMAWIVLDG 96 >ref|XP_022887365.1| laccase-4-like [Olea europaea var. sylvestris] Length = 349 Score = 64.7 bits (156), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 252 GVWFMHCHFDVHTSWGLRMAWIVQDG 175 GVWFMHCHFDVHTSWGLRMAWIV DG Sbjct: 307 GVWFMHCHFDVHTSWGLRMAWIVMDG 332 >gb|PRQ43239.1| putative laccase [Rosa chinensis] Length = 167 Score = 62.4 bits (150), Expect = 1e-08 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -2 Query: 252 GVWFMHCHFDVHTSWGLRMAWIVQDG 175 GVWFMHCH ++HTSWGLRMAWIVQDG Sbjct: 125 GVWFMHCHLEIHTSWGLRMAWIVQDG 150 >ref|XP_022846645.1| laccase-2-like [Olea europaea var. sylvestris] Length = 491 Score = 64.7 bits (156), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 252 GVWFMHCHFDVHTSWGLRMAWIVQDG 175 GVWFMHCHFDVHTSWGLRMAWIV DG Sbjct: 449 GVWFMHCHFDVHTSWGLRMAWIVMDG 474 >ref|XP_022971457.1| LOW QUALITY PROTEIN: laccase-17-like [Cucurbita maxima] Length = 576 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/34 (82%), Positives = 29/34 (85%), Gaps = 3/34 (8%) Frame = -2 Query: 267 FIFWA---GVWFMHCHFDVHTSWGLRMAWIVQDG 175 F F+A GVWFMHCHFDVHTSWGLRMAWIV DG Sbjct: 526 FRFYADNPGVWFMHCHFDVHTSWGLRMAWIVLDG 559 >ref|XP_010106521.1| laccase-2 [Morus notabilis] gb|EXC10697.1| hypothetical protein L484_025281 [Morus notabilis] Length = 577 Score = 64.3 bits (155), Expect = 2e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 252 GVWFMHCHFDVHTSWGLRMAWIVQDG 175 GVWFMHCHFDVH SWGLRMAWIVQDG Sbjct: 535 GVWFMHCHFDVHLSWGLRMAWIVQDG 560 >ref|XP_008240736.1| PREDICTED: laccase-17-like [Prunus mume] Length = 586 Score = 64.3 bits (155), Expect = 2e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 252 GVWFMHCHFDVHTSWGLRMAWIVQDG 175 GVWFMHCH DVHTSWGLRMAWIVQDG Sbjct: 544 GVWFMHCHLDVHTSWGLRMAWIVQDG 569 >gb|AFK35326.1| unknown [Medicago truncatula] Length = 172 Score = 61.6 bits (148), Expect = 3e-08 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -2 Query: 252 GVWFMHCHFDVHTSWGLRMAWIVQDG 175 GVWFMHCH +VHTSWGL+MAWIVQDG Sbjct: 130 GVWFMHCHLEVHTSWGLKMAWIVQDG 155 >gb|EYU41740.1| hypothetical protein MIMGU_mgv1a026682mg [Erythranthe guttata] Length = 564 Score = 63.9 bits (154), Expect = 3e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 252 GVWFMHCHFDVHTSWGLRMAWIVQDG 175 GVWFMHCHFDVHTSWGLRMAWIV DG Sbjct: 522 GVWFMHCHFDVHTSWGLRMAWIVLDG 547 >gb|PIN04756.1| Multicopper oxidase [Handroanthus impetiginosus] Length = 566 Score = 63.9 bits (154), Expect = 3e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 252 GVWFMHCHFDVHTSWGLRMAWIVQDG 175 GVWFMHCHFDVHTSWGLRMAWIV DG Sbjct: 524 GVWFMHCHFDVHTSWGLRMAWIVLDG 549 >gb|OIT01153.1| laccase-17, partial [Nicotiana attenuata] Length = 567 Score = 63.9 bits (154), Expect = 3e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 252 GVWFMHCHFDVHTSWGLRMAWIVQDG 175 GVWFMHCHFDVHTSWGLRMAWIV DG Sbjct: 525 GVWFMHCHFDVHTSWGLRMAWIVLDG 550 >gb|KZV27630.1| laccase-17-like [Dorcoceras hygrometricum] Length = 573 Score = 63.9 bits (154), Expect = 3e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 252 GVWFMHCHFDVHTSWGLRMAWIVQDG 175 GVWFMHCHFDVHTSWGLRMAWIV DG Sbjct: 531 GVWFMHCHFDVHTSWGLRMAWIVLDG 556 >ref|XP_023539539.1| laccase-17-like [Cucurbita pepo subsp. pepo] Length = 576 Score = 63.9 bits (154), Expect = 3e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 252 GVWFMHCHFDVHTSWGLRMAWIVQDG 175 GVWFMHCHFDVHTSWGLRMAWIV DG Sbjct: 534 GVWFMHCHFDVHTSWGLRMAWIVLDG 559 >ref|XP_020553486.1| laccase-17-like [Sesamum indicum] Length = 576 Score = 63.9 bits (154), Expect = 3e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 252 GVWFMHCHFDVHTSWGLRMAWIVQDG 175 GVWFMHCHFDVHTSWGLRMAWIV DG Sbjct: 534 GVWFMHCHFDVHTSWGLRMAWIVLDG 559 >ref|XP_019250476.1| PREDICTED: laccase-17-like [Nicotiana attenuata] Length = 580 Score = 63.9 bits (154), Expect = 3e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 252 GVWFMHCHFDVHTSWGLRMAWIVQDG 175 GVWFMHCHFDVHTSWGLRMAWIV DG Sbjct: 538 GVWFMHCHFDVHTSWGLRMAWIVLDG 563 >ref|XP_016468710.1| PREDICTED: laccase-17-like [Nicotiana tabacum] Length = 580 Score = 63.9 bits (154), Expect = 3e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 252 GVWFMHCHFDVHTSWGLRMAWIVQDG 175 GVWFMHCHFDVHTSWGLRMAWIV DG Sbjct: 538 GVWFMHCHFDVHTSWGLRMAWIVLDG 563 >ref|XP_009760365.1| PREDICTED: laccase-17-like [Nicotiana sylvestris] ref|XP_016481476.1| PREDICTED: laccase-17-like [Nicotiana tabacum] Length = 580 Score = 63.9 bits (154), Expect = 3e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 252 GVWFMHCHFDVHTSWGLRMAWIVQDG 175 GVWFMHCHFDVHTSWGLRMAWIV DG Sbjct: 538 GVWFMHCHFDVHTSWGLRMAWIVLDG 563 >ref|XP_019186338.1| PREDICTED: laccase-17-like [Ipomoea nil] Length = 582 Score = 63.9 bits (154), Expect = 3e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 252 GVWFMHCHFDVHTSWGLRMAWIVQDG 175 GVWFMHCHFDVHTSWGLRMAWIV DG Sbjct: 540 GVWFMHCHFDVHTSWGLRMAWIVLDG 565 >ref|XP_007208011.1| laccase-17 [Prunus persica] gb|ONI03455.1| hypothetical protein PRUPE_6G257700 [Prunus persica] Length = 585 Score = 63.9 bits (154), Expect = 3e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -2 Query: 252 GVWFMHCHFDVHTSWGLRMAWIVQDG 175 GVWFMHCH D+HTSWGLRMAWIVQDG Sbjct: 543 GVWFMHCHLDIHTSWGLRMAWIVQDG 568