BLASTX nr result
ID: Rehmannia30_contig00015589
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00015589 (473 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011099255.1| CASP-like protein 5C1 [Sesamum indicum] 54 3e-06 ref|XP_012852758.1| PREDICTED: CASP-like protein 5C1 [Erythranth... 54 6e-06 >ref|XP_011099255.1| CASP-like protein 5C1 [Sesamum indicum] Length = 151 Score = 54.3 bits (129), Expect = 3e-06 Identities = 28/55 (50%), Positives = 31/55 (56%) Frame = -1 Query: 473 IKRPARQRGILSIVVIGDWXXXXXXXXXXXXXXXXXXXXXXSEGFCDAKLCTRYQ 309 I+RP+RQRGILSIVV+GDW SEGFC KLCTRYQ Sbjct: 70 IRRPSRQRGILSIVVLGDWVLSFLSLAASCSTASVSSLLLASEGFCIGKLCTRYQ 124 >ref|XP_012852758.1| PREDICTED: CASP-like protein 5C1 [Erythranthe guttata] gb|EYU44324.1| hypothetical protein MIMGU_mgv1a015618mg [Erythranthe guttata] Length = 151 Score = 53.5 bits (127), Expect = 6e-06 Identities = 27/55 (49%), Positives = 30/55 (54%) Frame = -1 Query: 473 IKRPARQRGILSIVVIGDWXXXXXXXXXXXXXXXXXXXXXXSEGFCDAKLCTRYQ 309 IK PARQRGI+SIVVIGDW S+GFC +LCTRYQ Sbjct: 70 IKNPARQRGIISIVVIGDWVLSFLSLAASSSTASVTSLLLASDGFCSVRLCTRYQ 124