BLASTX nr result
ID: Rehmannia30_contig00015555
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00015555 (452 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011089262.1| uncharacterized protein LOC105170277 [Sesamu... 71 2e-11 gb|PIN18135.1| Transcription factor MEIS1 [Handroanthus impetigi... 64 8e-09 gb|EYU18807.1| hypothetical protein MIMGU_mgv1a002578mg [Erythra... 61 7e-08 ref|XP_012827886.1| PREDICTED: BEL1-like homeodomain protein 8 [... 61 7e-08 >ref|XP_011089262.1| uncharacterized protein LOC105170277 [Sesamum indicum] Length = 806 Score = 71.2 bits (173), Expect = 2e-11 Identities = 38/63 (60%), Positives = 47/63 (74%), Gaps = 2/63 (3%) Frame = +2 Query: 257 MDMTNFRPDQIHVAQQTRRDKLRFHHGSN--NMEVYANNMNQTLPSHDNGLNHENATFRN 430 MDM+NFRP+ +HVAQQ+RRDKLR H SN + +VY NN+ Q LP HD LN+E+ RN Sbjct: 1 MDMSNFRPE-LHVAQQSRRDKLRIQHDSNPPHYQVYPNNLQQ-LPPHD-ALNYESNNLRN 57 Query: 431 CRP 439 CRP Sbjct: 58 CRP 60 >gb|PIN18135.1| Transcription factor MEIS1 [Handroanthus impetiginosus] Length = 748 Score = 63.5 bits (153), Expect = 8e-09 Identities = 35/65 (53%), Positives = 45/65 (69%), Gaps = 4/65 (6%) Frame = +2 Query: 257 MDMTNFRPDQIHVAQQTRRDKLRFHHGSNNME----VYANNMNQTLPSHDNGLNHENATF 424 MDM+NFRP+ +HVAQQ+RRDKLR SN VY NN+ Q LP+ DN N++++ Sbjct: 1 MDMSNFRPE-LHVAQQSRRDKLRIQQDSNTSHHQFGVYLNNLEQ-LPA-DNAPNYDSSNL 57 Query: 425 RNCRP 439 RNCRP Sbjct: 58 RNCRP 62 >gb|EYU18807.1| hypothetical protein MIMGU_mgv1a002578mg [Erythranthe guttata] Length = 657 Score = 60.8 bits (146), Expect = 7e-08 Identities = 35/65 (53%), Positives = 43/65 (66%), Gaps = 4/65 (6%) Frame = +2 Query: 257 MDMTNFRPDQIHVAQQTRRDKLRFHHGSN----NMEVYANNMNQTLPSHDNGLNHENATF 424 MDM+NFRP+ +HVAQQ+RRDKLR H SN N+EVY NN+ Q H N+E+A Sbjct: 1 MDMSNFRPE-LHVAQQSRRDKLRIQHESNGPHHNIEVYINNLEQ--QQHHGLNNYESAIP 57 Query: 425 RNCRP 439 R RP Sbjct: 58 RTFRP 62 >ref|XP_012827886.1| PREDICTED: BEL1-like homeodomain protein 8 [Erythranthe guttata] Length = 669 Score = 60.8 bits (146), Expect = 7e-08 Identities = 35/65 (53%), Positives = 43/65 (66%), Gaps = 4/65 (6%) Frame = +2 Query: 257 MDMTNFRPDQIHVAQQTRRDKLRFHHGSN----NMEVYANNMNQTLPSHDNGLNHENATF 424 MDM+NFRP+ +HVAQQ+RRDKLR H SN N+EVY NN+ Q H N+E+A Sbjct: 1 MDMSNFRPE-LHVAQQSRRDKLRIQHESNGPHHNIEVYINNLEQ--QQHHGLNNYESAIP 57 Query: 425 RNCRP 439 R RP Sbjct: 58 RTFRP 62