BLASTX nr result
ID: Rehmannia30_contig00014666
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00014666 (542 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN07329.1| SAP family cell cycle dependent phosphatase-assoc... 57 5e-06 >gb|PIN07329.1| SAP family cell cycle dependent phosphatase-associated protein [Handroanthus impetiginosus] Length = 790 Score = 56.6 bits (135), Expect = 5e-06 Identities = 39/92 (42%), Positives = 51/92 (55%), Gaps = 10/92 (10%) Frame = +3 Query: 96 SNSTNTTDAAEEPSLPNGELQVEL-GAPNIVGTDKTIA--------PDDCETDRGGPLHR 248 SNS NT +A + PSLPNGELQV++ G P+IVG DK +A D+C T+ G Sbjct: 687 SNSANTANATQPPSLPNGELQVQVEGQPDIVGADKNVATPTSAVGPADNCMTEGGASPDS 746 Query: 249 KRL-SLEQILHIHRSG*KRNRSGEKIGSRVGT 341 K + S L +G + N S EK+ S GT Sbjct: 747 KEINSGSNPLQTKEAG-EGNCSIEKVESNAGT 777