BLASTX nr result
ID: Rehmannia30_contig00014560
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00014560 (417 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020550185.1| ribosomal RNA small subunit methyltransferas... 65 1e-09 ref|XP_011091437.1| ribosomal RNA small subunit methyltransferas... 65 1e-09 ref|XP_022859409.1| ribosomal RNA small subunit methyltransferas... 65 2e-09 ref|XP_012843652.1| PREDICTED: probable dimethyladenosine transf... 62 2e-08 gb|PIN16240.1| Ribosomal RNA adenine dimethylase [Handroanthus i... 58 4e-07 ref|XP_002270274.1| PREDICTED: ribosomal RNA small subunit methy... 54 8e-06 >ref|XP_020550185.1| ribosomal RNA small subunit methyltransferase, chloroplastic isoform X2 [Sesamum indicum] Length = 322 Score = 65.1 bits (157), Expect = 1e-09 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -3 Query: 415 DIEAALCSANLPPTSRPEELTLQDFVRLHNLLVKT 311 DIEAALC+A LPPTSRPEELTL+DFV+LHNL+ KT Sbjct: 288 DIEAALCAAGLPPTSRPEELTLEDFVKLHNLIAKT 322 >ref|XP_011091437.1| ribosomal RNA small subunit methyltransferase, chloroplastic isoform X1 [Sesamum indicum] Length = 350 Score = 65.1 bits (157), Expect = 1e-09 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -3 Query: 415 DIEAALCSANLPPTSRPEELTLQDFVRLHNLLVKT 311 DIEAALC+A LPPTSRPEELTL+DFV+LHNL+ KT Sbjct: 316 DIEAALCAAGLPPTSRPEELTLEDFVKLHNLIAKT 350 >ref|XP_022859409.1| ribosomal RNA small subunit methyltransferase, chloroplastic [Olea europaea var. sylvestris] Length = 362 Score = 64.7 bits (156), Expect = 2e-09 Identities = 31/44 (70%), Positives = 37/44 (84%) Frame = -3 Query: 415 DIEAALCSANLPPTSRPEELTLQDFVRLHNLLVKTTYLI**HLE 284 +IEAALC LPPT+RPEELTL+DFV+LHNL+VKT +L HLE Sbjct: 321 EIEAALCGVGLPPTARPEELTLEDFVKLHNLIVKTPFLD--HLE 362 >ref|XP_012843652.1| PREDICTED: probable dimethyladenosine transferase [Erythranthe guttata] gb|EYU32049.1| hypothetical protein MIMGU_mgv1a009260mg [Erythranthe guttata] Length = 348 Score = 62.0 bits (149), Expect = 2e-08 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -3 Query: 415 DIEAALCSANLPPTSRPEELTLQDFVRLHNLLVK 314 DIE+ALC+A+L PTSRPEELTL+DFVRLHNLLVK Sbjct: 314 DIESALCAADLLPTSRPEELTLEDFVRLHNLLVK 347 >gb|PIN16240.1| Ribosomal RNA adenine dimethylase [Handroanthus impetiginosus] Length = 346 Score = 58.2 bits (139), Expect = 4e-07 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -3 Query: 415 DIEAALCSANLPPTSRPEELTLQDFVRLHNLLVKT 311 +IEAAL +A LP TSRPEELTL+DFV+LHNL+VKT Sbjct: 312 EIEAALLTAGLPATSRPEELTLEDFVKLHNLIVKT 346 >ref|XP_002270274.1| PREDICTED: ribosomal RNA small subunit methyltransferase, chloroplastic [Vitis vinifera] emb|CBI38785.3| unnamed protein product, partial [Vitis vinifera] Length = 335 Score = 54.3 bits (129), Expect = 8e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -3 Query: 415 DIEAALCSANLPPTSRPEELTLQDFVRLHNLLVKT 311 +IE AL + LP TSRPEELTL DFVRLHNL+VKT Sbjct: 301 EIEEALRNVGLPATSRPEELTLDDFVRLHNLIVKT 335